KEGG   Sphingobacterium sp. B29: BV902_01225Help
Entry
BV902_01225       CDS       T04670                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
sphn  Sphingobacterium sp. B29
Brite
KEGG Orthology (KO) [BR:sphn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BV902_01225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: APU95116
UniProt: A0A1P8DZM8
Position
272776..273162
Genome map
AA seq 128 aa AA seqDB search
MITQITEGVKISVETIYQSEYSNPDREHFMFAYHISIENLSDYTVQLISRYWKIFDAKGD
YREVSGEGVVGEQPIIEPGQTHQYTSGCNLNSEFGFMEGYYNMIRTLDNGSFQVEIPRFN
LIADYALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatcacacaaattacagaaggcgtaaaaatctcggttgaaaccatctatcaatcagag
tattcgaatccggaccgtgaacatttcatgtttgcttatcatatcagcatagaaaatctc
agcgattacacggttcaattgataagtcgctattggaaaatctttgacgcaaaaggagac
tatagggaggtatctggagaaggggtagtaggcgaacaacctattatagaacctggccag
actcatcagtatacctcaggttgcaatctcaatagcgaattcggattcatggaaggatat
tacaatatgatccgaacactggacaacggcagctttcaagttgaaataccacgtttcaat
ctgatagctgattacgcattgaattaa

DBGET integrated database retrieval system