KEGG   Sphingobacterium sp. B29: BV902_04260Help
Entry
BV902_04260       CDS       T04670                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sphn  Sphingobacterium sp. B29
Pathway
sphn00250  Alanine, aspartate and glutamate metabolism
sphn00330  Arginine and proline metabolism
sphn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BV902_04260
   00330 Arginine and proline metabolism
    BV902_04260
Enzymes [BR:sphn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BV902_04260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Tape_meas_lam_C
Motif
Other DBs
NCBI-ProteinID: APU95645
UniProt: A0A1P8E147
Position
999955..1001592
Genome map
AA seq 545 aa AA seqDB search
MSKGFFTVPVPTNEPVYTYAVGTKERKLLKAAIDEARSKQIDIPMYIGGKEITTSKKVNL
APPHDHQHILGQYNQGDKSHVTDAINAALAAKKDWENLTWEDRAAIFLKAAELISGKYRY
ELNAATMLGQSKNPYQAEIDSACEIVDFLRFNVQYMSEIYKQQPPISGKGVWNRVEQRPL
EGFVFALTPFNFTAIAGNLPSCVAMMGNVVVWKPSNTQIYSANVLMKIFREAGLPDGVIN
LVYVSGPDAGDVIFQHPDFAGIHFTGSTGVFQDIWKTIGNNIHRYKTYPRIVGETGGKDF
IVVHPSADLKAANTALVRGAFEYQGQKCSAASRAYIPKSLWPALKESMTTDVKSFTIGGT
EDFTNFFNAVIDEKSFDKLAKYIDRAKESNDAEIVVGGTYDKSKGYFIHPTIIEASKPDY
ETMVEELFGPVLTVYVYEDAKFEETLDIVDTTSIYALTGSIIAQDRYAINLATDKLRHAA
GNFYVNDKCTGAVVGQQPFGGARGSGTNDKAGSMINLLRWVSPRTIKETFNPDTDYRYPF
LEKGE
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggattttttacagttcctgttcctaccaatgaaccggtgtacacatacgct
gtcggaacgaaagaacgtaaattgttgaaagcagcaattgatgaggcacgttcgaaacaa
atcgatatcccaatgtatattggtggtaaagaaatcactacttctaaaaaagtaaaccta
gctcctccacatgaccaccaacatattttaggtcaatacaatcaaggcgataaatctcac
gtaacagatgcaatcaatgcagctttagcggcaaaaaaggattgggaaaaccttacttgg
gaagatcgtgctgcgatattcttaaaagctgctgaattgatttcgggaaaataccgttat
gaattgaatgctgctacgatgttggggcaatcgaaaaacccatatcaggcagaaattgat
tcggcatgtgagattgtggatttcttgcgtttcaatgtacaatacatgagcgaaatctat
aaacaacaaccccctatatcgggtaaaggtgtttggaaccgtgtagaacaacgtcctctt
gaaggttttgtatttgcattgactccattcaattttacagctattgcgggtaatctacct
tcctgtgttgcaatgatgggtaatgttgtggtatggaaaccatccaatacccaaatttat
tcagcaaatgtattgatgaaaattttccgtgaagcgggtcttcccgatggtgtaatcaac
ttggtgtatgtttcaggtcctgatgcaggtgacgtaattttccaacacccagatttcgca
ggtatccacttcactggttcaacaggagtatttcaggatatctggaagacgatcggtaac
aatatccaccgttataaaacgtatccacgtatcgtcggtgagactggtggtaaggatttt
atcgttgtacacccttcggccgatttaaaagctgcaaatacagctttggttcgtggtgct
ttcgaataccaaggtcaaaaatgttctgcggcatcgcgtgcatacattcctaaatccttg
tggcctgcattgaaagaatctatgacgactgacgtaaaatcttttacaatcggtggaaca
gaagattttacaaactttttcaatgctgtaattgatgagaagtcatttgataaattagcg
aagtatatcgacagagctaaagaatctaatgacgcagaaattgtagttggtggtacatac
gataaatctaaaggatatttcattcatccaacaatcattgaggcttcaaaaccggattac
gagacaatggttgaggaattgtttggacctgtcttgaccgtatatgtttacgaggatgct
aagtttgaagaaaccttagatattgttgatacaacatctatttatgccttgactggatca
atcattgcgcaagatcgctatgccattaatttagcaacagataaattaagacatgccgct
ggtaacttctacgtgaatgataagtgtacaggtgctgtcgtaggtcaacaaccgtttggt
ggtgctagaggctcgggtacaaacgacaaagcgggatcaatgatcaatttgcttcgttgg
gtgtctcctcgtacaatcaaagaaacatttaatccagatacagattatagataccctttc
ttggaaaagggagaataa

DBGET integrated database retrieval system