KEGG   Sphingobacterium sp. B29: BV902_04540Help
Entry
BV902_04540       CDS       T04670                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sphn  Sphingobacterium sp. B29
Pathway
sphn00511  Other glycan degradation
sphn00520  Amino sugar and nucleotide sugar metabolism
sphn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BV902_04540
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BV902_04540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sphn03110]
    BV902_04540
Enzymes [BR:sphn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BV902_04540
Chaperones and folding catalysts [BR:sphn03110]
 Intramolecular chaperones
  Others
   BV902_04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b CHB_HEX_C_1 Fn3_assoc DUF5626
Motif
Other DBs
NCBI-ProteinID: APU95694
UniProt: A0A1P8E1E5
Position
complement(1062735..1064969)
Genome map
AA seq 744 aa AA seqDB search
MLLLGGATIFTAHAQTNFDIIPKPSKITLATGTYAIPTHLQVIVSDEFQEATQLLTEHPA
IKSLAVEVLKKNKKGPKEGFRIIKAVDADNLSKNAYSIQIDEKGLLLRAWNVPQVINGIY
TLVQLGYLQADPSKIAYATIVDEPRFAYRGLHLDVSRHFMPLSFVKKYIDIMAIYKFNNF
HWHLTDGAGWRLEIKKYPELTQKAAWRTHTGWKDWWNNGRQYVEKGKPNASGGFYTQEEA
RELVDYAARKGINVIPEIEMPGHSEEVLAVYPELSCSGKPYSQGEFCIGNEKTFEFLKNV
LDEVLTIFPSQYIHIGGDEAEKKHWETCPKDQALMQKEGLKSVDELQSYAIKQMDLYLQS
KGRKLIGWDEILQGGLTEGATVMSWRGEDGGIKAANAGHDVIMTPGSHLYFDSYQTDPRT
QPEAIGGYLTLDKVYSYDPIPAAIQGDKAKHILGAQANIWTEYVPTTEHLEYMVFPRALA
LAEVNWTNKDGKSWTDFQRRLQSHYKLLQDLNVNYYRPSFNVAYTATYNAAKNNNKITLT
TEQLKTDQIRYTIDSSEPTILSTPYTGPFELSSTGHINAAYFLDSIKIGPTLSFDIDIHR
AIGKKVTYNTAWSGYPAQKDSTLTNGIMGGLSYHDGQWQGFTSPIDVVVDMERREEIHQV
AMNFMQMIGPGVYMPGEMEVLLSDNGRTFRSVGTIKNDISDKESKLTFKRFELKLDKAQQ
ARYIKIKASNPKKGYLFTDEIIVY
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgttgttacttgggggtgcaaccatctttactgcacatgcccaaaccaactttgacatt
atacccaaaccttcgaaaatcacattggctacgggaacatacgctatccctacacatctt
caggttattgtttcagatgaatttcaggaggcgacacaactgcttactgaacacccagct
atcaaaagcctagctgtcgaagtactcaagaaaaataaaaaaggcccaaaagaaggcttt
cgcattattaaagcagtcgatgcagataaccttagcaagaacgcctattccatccaaatc
gatgaaaaaggcctgctactcagagcctggaatgtaccccaggttatcaatgggatttac
acactggttcaattgggctatctacaagctgatccaagtaaaatagcctatgcgactata
gtcgatgagccacgatttgcctaccgtggcttacacctggatgtatcgcgccattttatg
ccactatcttttgtcaaaaagtatatcgacatcatggccatctacaaattcaacaatttt
cattggcatttaaccgacggagcgggatggcgattggagattaagaaatatccggagtta
acacaaaaggcggcctggcgtacacatacgggctggaaagattggtggaacaatggtcgt
cagtatgtagaaaaaggtaagccaaatgccagcggtggattctatacccaggaagaagca
cgcgaattggtcgactatgcagcccgtaaaggaatcaatgtaattcctgagatagaaatg
cccggacattcggaagaagtattggccgtatatcccgaactctcttgctccggaaagccc
tatagtcagggagaattctgtatcggcaatgaaaaaacctttgaatttctaaaaaatgtt
ttggatgaagtactcacgatattcccttcccagtacattcatatcggcggtgatgaagct
gagaagaagcattgggaaacctgcccaaaagatcaggcgctcatgcaaaaagaaggatta
aaatctgttgacgaactgcagagttatgctatcaaacaaatggatctatacctgcaatcc
aagggtagaaagctgatcggttgggacgaaatccttcaaggggggctcacagaaggagct
accgtcatgagctggcgcggtgaagacggcggcataaaggccgcaaatgcaggccatgat
gtcatcatgactccaggttcacacctctattttgattcttatcagacagacccacggaca
cagcctgaggccatcgggggttacctgacattagataaagtttattcgtatgatcctatt
ccagctgcgatacaaggggacaaagccaagcatatcctcggagcacaagcgaatatatgg
acagaatatgtacctaccaccgaacacctcgaatatatggtgttcccacgtgcactggct
ttggcggaagtcaattggacaaataaagatgggaaaagctggacagactttcagcgaaga
ctacaatcacattataagctactacaagatctaaacgtcaattattatcgtccttccttt
aatgtcgcttatacagcaacatacaatgctgctaaaaacaacaataaaattacgctgaca
acggagcaactaaaaacagatcagatccgatataccattgatagcagtgagcctacaatc
ttgtctacaccatatactggaccatttgaactcagctcaacaggtcatatcaatgccgct
tattttctagattctatcaaaatcggtccaaccctatcctttgatattgacattcatcgt
gctattggaaaaaaagtaacgtacaacacagcatggtcgggatatccagcacaaaaagat
tctaccttaacaaacggaatcatgggcggtctttcctatcacgatggtcaatggcaagga
ttcaccagtccgattgatgttgtcgtggatatggaacgcagggaggaaatacaccaagta
gccatgaattttatgcagatgatcggccccggcgtttatatgccaggagaaatggaagtc
ctgctttcggataatggccgtaccttcagatctgtaggaacaatcaaaaatgatatatcc
gataaagaatccaaattaacatttaaacgtttcgagctgaaactagataaagcgcagcag
gcacgctacataaaaatcaaggccagcaatccgaaaaaaggatatttatttacagacgaa
attattgtttattaa

DBGET integrated database retrieval system