KEGG   Sphingobacterium sp. B29: BV902_20325Help
Entry
BV902_20325       CDS       T04670                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sphn  Sphingobacterium sp. B29
Brite
KEGG Orthology (KO) [BR:sphn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BV902_20325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 BslA
Motif
Other DBs
NCBI-ProteinID: APU98396
UniProt: A0A1P8E902
Position
complement(4707111..4708511)
Genome map
AA seq 466 aa AA seqDB search
MIPLLGETDLSTGLLIVFALCLFAVVAFEFVNGFHDTANAVATVIYTKALKPIVAIPWSG
FWNFLGVFAGGIAVAMGILKLVPLDTLMALPVSVGACLVLAVLLAAIIWNLGTWYFGIPC
SSSHTLIGALIGAGIGFTWYYGGSGVNWHKAEEIGLSLILSPLIGFGLAVLLMLFLKHVV
RYKALFHIPQGEDDRPPLLVRGILILTCTLVSFFHGSNDGQKGVGLFMLILIAFLPARFS
INHSVPDAAVIKTLDQTEIVLQRIASSNVAQGTMFVQVNQEIEQVKLHLMDKSVTDKAGT
FKFRKEVEGLVKSIATLESSKQIDINPENRLELNRKLGELKHLTDFAPIWVILTISIALG
LGTMIGWKRIVVTIGEKIGNEHLSYAQGASSEIVAASTIGISTVLGLPVSTTHVLSSGIA
GSMVASGGKSNLNKGTLKSIGLAWVLTLPVSIGLALLLFVFFHLFI
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgattcctctcttaggggaaaccgatcttagtactggacttcttattgtttttgccctt
tgtttatttgccgttgtggcctttgaatttgtcaatggctttcatgataccgcgaatgct
gttgcaacggtaatttataccaaagcacttaaaccaattgtagccattccttggtctggc
ttttggaattttctaggtgtttttgcaggtgggatcgcagttgctatgggaatacttaaa
ttggtgcctctcgataccttaatggcactacctgtttcggtaggcgcttgcctggtcctt
gctgtattattagcggctattatctggaatttggggacctggtattttggtattccatgt
tcgagttcacatactttgattggtgctcttatcggggctggtataggcttcacctggtat
tatggtggcagtggtgtcaattggcataaggccgaggaaattggtctttctttgattctc
tcacctttgattggttttggtttagcagtgttattgatgctctttttaaagcatgtcgtc
cgttataaagcactttttcacatcccacagggagaagatgacagacctcccttgttagta
cgcggtattcttatactgacctgtacattggtcagtttttttcacggtagcaacgatgga
caaaaaggtgtaggactgtttatgttgatcttaattgcatttctgcctgctcgtttttca
atcaaccattccgtaccagatgcggctgtcattaaaacgctcgatcaaacggaaatcgtg
ttacagagaattgcttccagtaatgtcgctcagggaacgatgtttgtgcaagtcaatcag
gagattgagcaagtcaagttgcatttgatggataaaagtgtaacggataaagccggtact
tttaaattcagaaaagaggttgaaggtttagttaaatccattgctacattagagagcagt
aaacagatcgatatcaatcctgaaaatcgattggagcttaatcgtaagttgggcgaattg
aaacatcttacggactttgcaccgatctgggtgatcttaactatttcaatcgccttaggt
cttgggacaatgatcggttggaaacgtattgtagtaacgattggtgaaaaaataggaaat
gaacatttaagttatgctcaaggagcctcaagcgagattgttgctgcttcgacaattggt
atcagtaccgtattgggtttgccggttagtacaacgcatgtgctttcaagtggtattgcc
ggttcaatggtcgcttctggaggaaagagcaatctgaataaagggacactcaaaagtatc
ggtcttgcctgggtacttaccttacccgtgtcaattggcttggcattattactatttgta
ttcttccatctttttatttag

DBGET integrated database retrieval system