KEGG   Sphingopyxis sp. MG: C3E99_02880Help
Entry
C3E99_02880       CDS       T05382                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
spho  Sphingopyxis sp. MG
Pathway
spho00260  Glycine, serine and threonine metabolism
spho01100  Metabolic pathways
spho01110  Biosynthesis of secondary metabolites
spho01120  Microbial metabolism in diverse environments
spho01130  Biosynthesis of antibiotics
spho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C3E99_02880
Enzymes [BR:spho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C3E99_02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AVA15765
UniProt: A0A2L0VV39
Position
633569..634570
Genome map
AA seq 333 aa AA seqDB search
MRFFSDNAAAVHPAVMDALAAANHVDTAYDGDALSRSLDAAFSDLFETECEVVWISTGTA
ANSIILAHFVRPWQGILCYEEAHIEVDECGAPTFYSGGAKLMPLPGTGAKIDADALKARI
AGIRADVHQVQPAAISITNATEYGLSWRPDEVAEISEIAKASGMKLHMDGARFANAVAFL
GCTPADVTWRAGVDALSFGFTKNGAMMAEALVFFGGSGGAGVRELKKRGGHLLSKGRFVA
AQIRAMLKDDLWLANARAANAGAAALAAACGDRLMYPVEANELFVRLTAEEAADLRAQGF
DFYDWGEGAARLVTSWDQDAASTAPLAAAIAAL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ctgcgcttcttttccgacaatgcggctgcggtccatcccgcggtcatggacgctctcgcc
gcggcgaaccacgtcgataccgcctatgacggcgacgcgctcagccggtcgctcgacgcg
gccttttcggacctgttcgaaacggagtgcgaggtcgtctggatttcgaccggaaccgcg
gcgaacagcattatcctcgcccatttcgtgcggccgtggcagggcatcctctgctatgag
gaagcgcatatagaggtcgacgaatgcggcgccccgaccttctattcgggcggcgccaag
ctgatgccgctgcccggcacgggggcgaagatcgacgccgatgcgctgaaggcgcgaatc
gccggcatccgcgccgacgtccaccaggtccagccggcggcgatcagcatcaccaacgcg
acagaatatggcctgtcctggcgtcccgacgaggtcgccgagatcagcgagatcgcgaag
gccagcggcatgaagctgcacatggacggcgcgcgcttcgccaatgcggtcgcctttctc
ggctgcacgccggccgacgtcacctggcgcgccggggtcgacgcgctgtcgttcggcttc
accaagaacggcgcgatgatggccgaggcgctggtgttcttcggcggcagcggcggtgct
ggcgtacgcgaactcaagaagcgcggcgggcacctgctcagcaaggggcgcttcgtcgcg
gcgcagatccgcgcgatgctgaaggacgatctgtggctcgccaacgcgcgcgccgccaac
gccggggcggcggcgctcgccgcggcctgcggcgaccggctgatgtatccggtcgaggcg
aacgagctgttcgtgcggctgaccgccgaagaggcggccgatctgcgcgcacagggattc
gatttctacgactggggcgaaggcgccgcgcgcctcgtcaccagctgggatcaggacgcc
gcctcgacggcgccgctcgcggcggcgatcgccgcgctatga

DBGET integrated database retrieval system