KEGG   Sphingopyxis sp. MG: C3E99_09265Help
Entry
C3E99_09265       CDS       T05382                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
spho  Sphingopyxis sp. MG
Pathway
spho00480  Glutathione metabolism
spho00590  Arachidonic acid metabolism
spho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C3E99_09265
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C3E99_09265
Enzymes [BR:spho01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C3E99_09265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AVA14000
UniProt: A0A2L0VQ11
Position
complement(1989923..1990402)
Genome map
AA seq 159 aa AA seqDB search
MTLYDLSAPLPDGGTKPMADYRGKVLLIVNTASKCGFTPQYKELEALYRDYKDRGFEVLA
FPCNQFGAQEPGDADEIANFCSLTYDVSFPVMAKIDVNGSGADPIFKHLKDEKTGLLGSG
IKWNFTKFLVDREGNVVSRHAPTTRPELLREEIEALLGA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgctctacgatctttcggcgccgctgccggacggcgggacgaaaccgatggccgat
tatcgcggcaaggtgctgctgatcgtcaacaccgcgtcgaaatgcggctttaccccgcaa
tataaggagttggaggcgctttaccgcgattacaaggatcgcgggttcgaggtgctggcc
tttccctgcaaccagttcggcgcgcaggagccgggcgacgccgacgaaatcgccaatttc
tgttcgctcacctatgacgtgagctttccggtgatggcgaagatcgacgtcaacgggtcg
ggcgccgacccgatcttcaagcatctgaaggacgagaagaccggcctgctcggtagcggg
atcaagtggaatttcaccaagttcctggtggatcgcgagggcaatgtggtgtcgcgccac
gccccgaccacgcggccggaattgctgcgcgaggaaatcgaggcgttgctgggagcgtga

DBGET integrated database retrieval system