KEGG   Sphingopyxis sp. MG: C3E99_11645Help
Entry
C3E99_11645       CDS       T05382                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
spho  Sphingopyxis sp. MG
Pathway
spho00360  Phenylalanine metabolism
spho00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spho00790  Folate biosynthesis
spho01100  Metabolic pathways
spho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    C3E99_11645
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C3E99_11645
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C3E99_11645
Enzymes [BR:spho01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     C3E99_11645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AVA14416
UniProt: A0A2L0VR73
Position
complement(2517875..2518747)
Genome map
AA seq 290 aa AA seqDB search
MENPPSHVHATPPPGAAPDWTCPQDWDAFTADEHAMWDCLFARQSAMLPGRASDAFLRGI
DVLRLEKPGIPDYRDLNARLTEATGWRVVAVPGLVPDDVFFDHLANRRFPAGNFIRTPRQ
LDYLQEPDVFHDVFGHVPMLADPVFADYMAAYGRGGLRSLKYDALKQLARLYWYTVEFGL
IREGGTLRIYGAGIVSSYAESLFALDSESPNRIGFDLSRVMRTDYRIDDFQQNYFVVDSL
DQLLDVTVNTDFAPLYAANAALPPIPIADILPGDTVITRGTQEYALAKSG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacccgcccagccacgtccacgccaccccgccgccgggcgccgcgcccgactgg
acgtgtccgcaggactgggacgccttcaccgccgacgagcatgcaatgtgggactgcctc
ttcgcgcgccagtcggcgatgctgcccggccgcgcgtccgacgcttttctgcgcggcatc
gacgtgcttcggctcgaaaagccgggcattcccgactatcgcgacctcaacgcgcgactg
acggaggcgaccgggtggcgcgtcgtcgcggtgccggggctggtgcccgacgatgtcttc
ttcgaccatctcgccaatcgccgttttccggcgggcaattttatccgcaccccgcggcag
ctcgactatctgcaggagcccgacgtcttccacgacgttttcggtcacgtcccgatgctc
gccgatccggtgttcgccgactatatggccgcctatggccggggcgggttgcgcagcctg
aaatatgatgcgttgaagcagcttgcgcgcctttattggtacactgtcgagttcgggctg
atccgcgagggcggcacgctgcgcatctatggcgcgggcatcgtctcctcctacgccgaa
agcctgttcgcgctcgattcggagagcccgaaccgcatcggcttcgacctgtcgcgggtg
atgcgcaccgattaccggatcgacgatttccagcagaattatttcgtcgtcgacagtctg
gaccagttgctcgacgtcacggtgaacaccgatttcgcgccgctctatgccgccaacgcc
gcgctgccgccgatcccgatcgccgacatcctgcccggcgatacggtcatcacgcgcggc
acacaggaatatgcgctggcgaaaagcggctga

DBGET integrated database retrieval system