KEGG   Sphingopyxis sp. 113P3: LH20_00795Help
Entry
LH20_00795        CDS       T04069                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00650  Butanoate metabolism
sphp00900  Terpenoid backbone biosynthesis
sphp01100  Metabolic pathways
sphp01110  Biosynthesis of secondary metabolites
sphp01120  Microbial metabolism in diverse environments
sphp01130  Biosynthesis of antibiotics
sphp01200  Carbon metabolism
sphp01212  Fatty acid metabolism
sphp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH20_00795
   00630 Glyoxylate and dicarboxylate metabolism
    LH20_00795
   00640 Propanoate metabolism
    LH20_00795
   00650 Butanoate metabolism
    LH20_00795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH20_00795
   00072 Synthesis and degradation of ketone bodies
    LH20_00795
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH20_00795
   00310 Lysine degradation
    LH20_00795
   00380 Tryptophan metabolism
    LH20_00795
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH20_00795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH20_00795
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH20_00795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphp04147]
    LH20_00795
Enzymes [BR:sphp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH20_00795
Exosome [BR:sphp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH20_00795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALC10481
UniProt: A0A0M5IW84
Position
complement(187692..188894)
Genome map
AA seq 400 aa AA seqDB search
MHEAVIVSTARTPIGKAYRGAFNDTQGQALAGHAIKHAVARAGLEGGEIEDSVFGCALQQ
GSTGFNVARQGALWAGLPETVPGTTLDRQCGSGLMAIAAAANRIQAGEQKIAVAGGVESI
SLVQNNHMNGYRNADPKLLAEIPQLYMGMLETAEIVADRYGISRDAQDEYALQSQQRVAE
AQAAGRFTAEIAPMTTTMLVTDKATGDTSRREVTLEQDEGNRPQTSLADLQKLQPVFKGG
QQVQEGRFITAGNASQLSDGAAAVVLMEAREAERRGLQPLGAYRGLAVAGCGPEEMGIGP
VFAIPKLLAAHGLGVDDIDMWELNEAFASQVLYCRDKIGIPNDRYNVSGGAISIGHPYGM
SGARMTGHIMHEGKRRGAKYGVVTMCMGGGMGGAGLFEIF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaagccgtaattgtctcgaccgcccgtacgcccatcggaaaagcctatcgaggt
gcgttcaacgatacgcaggggcaggcgctcgccggccatgcgatcaaacacgccgtcgct
cgcgccggcctggaaggcggcgaaatcgaggattcggtcttcggctgcgcgctccagcaa
gggtcgaccggtttcaacgtagcgcgccagggcgcgctgtgggcgggacttcccgaaacg
gttcccgggaccacgctagaccgtcagtgcggatcgggcctgatggcaatcgctgctgcg
gccaaccggattcaggcgggcgagcagaagattgcggtggcgggcggggtcgaatcgatc
agcctcgttcaaaacaaccacatgaacggctatcgcaatgccgatcccaagctgctcgcc
gagattccgcagctctatatgggcatgctcgaaactgcggaaatcgtcgcggatcgctat
ggcatcagccgcgacgcgcaggacgaatatgcgctccagtcgcagcagcgtgtcgccgaa
gcgcaggcggctggccgtttcacggccgaaatcgcgccgatgaccacgacgatgctggtc
accgacaaggcaaccggcgacacgtcgcggcgcgaagtgacgctggaacaggatgaaggc
aatcgtccccaaacgtcgcttgccgacctccagaagctccagccggtgttcaagggtggg
cagcaggtgcaggaaggccgcttcatcaccgccggcaatgcctcgcaactgtccgatggt
gcggcggcggtcgtgctcatggaagccagggaggccgaacggcgcgggctgcagccgctc
ggcgcctatcgcggcctcgcggtcgccggctgcggacccgaggaaatggggatcggccct
gtctttgccattcccaagctgctcgcggcgcacggcctcggcgtcgacgatatcgacatg
tgggagctgaacgaggccttcgcgagccaggtcctttactgccgcgacaagatcggcatt
cccaacgaccgctacaatgtatcgggcggggcgatctcgatcggccatccctacggcatg
tccggcgcgcgcatgacggggcacatcatgcacgaaggcaagcgccgcggcgcgaaatac
ggcgtcgtcaccatgtgcatgggcgggggcatggggggagccggactctttgaaatcttc
tga

DBGET integrated database retrieval system