KEGG   Sphingopyxis sp. 113P3: LH20_02370Help
Entry
LH20_02370        CDS       T04069                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00260  Glycine, serine and threonine metabolism
sphp01100  Metabolic pathways
sphp01110  Biosynthesis of secondary metabolites
sphp01120  Microbial metabolism in diverse environments
sphp01130  Biosynthesis of antibiotics
sphp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LH20_02370
Enzymes [BR:sphp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LH20_02370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALC10789
UniProt: A0A0M3QCE2
Position
520970..521980
Genome map
AA seq 336 aa AA seqDB search
MTATRFFSDNAAAVHPAVMEAIAAANHVDTAYDGDALSQSLDDAFSQLFETRCEVVWMAS
GTAANSIILAHFVRPWQGIFCHEEAHIEVDECGAPTFYSGGAKLMPLPGSGAKIDVEALR
ERLAAIRNDVHQVQPAAISITNATEYGLAWRPDEIAAIGEVARAAGLRLHMDGARFANAI
AFLDCAPADVTWRAGVDALSFGFTKNGAMMAEALVFFGGCGGAGVRELKKRGGHLLSKGR
FVAAQIHAMLRNDLWLDNARAANAGAVALAAACDKRLIHPVEANELFVRLAAEEATRLRA
AGYDFYDWGKDAARLVVSWDQDADAVAPLATAIATL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgacgcgcttcttctccgacaatgctgcagccgtgcatcctgcggtgatggag
gctatagccgctgccaaccacgtcgataccgcctatgacggcgacgcgctcagccaatcg
ctcgacgacgcattttctcagctcttcgaaacccgctgcgaagtggtctggatggcgtcg
gggacagcggccaacagcatcatcctcgcccattttgtgcggccatggcagggcattttc
tgccatgaagaggcgcatatcgaggtcgatgaatgtggggcgccaaccttttattcgggc
ggtgcaaagttgatgccgcttcccggaagcggcgccaagatcgacgttgaagcgctccga
gagcggcttgccgccatacgcaacgatgtccatcaggttcagcccgcggcaatcagcatc
accaatgcaaccgaatatggtctcgcgtggcgtccggacgagatcgctgcgatcggcgag
gttgcgcgcgccgcgggattgaggctgcacatggatggcgcgcgctttgccaatgccatt
gcctttctcgactgcgcccctgcggatgtgacgtggcgcgcgggcgttgatgccttgtcg
ttcggctttacgaaaaatggcgcaatgatggctgaggcgctcgttttctttggcggatgc
ggcggtgcaggggtgcgcgaactcaagaagcgcggcgggcatctgctcagcaaggggcgc
ttcgtcgcggcgcagattcacgcgatgctgcgaaacgacctgtggctggataatgcgcgt
gcggcgaatgccggcgcggtagcgctggccgcggcctgtgacaagcggctgatccacccg
gtcgaggcaaatgagttgtttgtccgcctggccgcagaggaagcgacgcgtttgcgggcc
gcgggctatgatttttatgactggggcaaagacgcggcgcgcctggtcgtcagctgggac
caggacgccgacgcggtcgcaccgcttgccactgcgatcgctaccctatga

DBGET integrated database retrieval system