KEGG   Sphingopyxis sp. 113P3: LH20_11825Help
Entry
LH20_11825        CDS       T04069                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LH20_11825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sphp01007]
    LH20_11825
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sphp03016]
    LH20_11825
   03029 Mitochondrial biogenesis [BR:sphp03029]
    LH20_11825
Enzymes [BR:sphp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     LH20_11825
Amino acid related enzymes [BR:sphp01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   LH20_11825
Transfer RNA biogenesis [BR:sphp03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LH20_11825
 Prokaryotic Type
   Other AARSs
    LH20_11825
Mitochondrial biogenesis [BR:sphp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LH20_11825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD
Motif
Other DBs
NCBI-ProteinID: ALC12641
UniProt: A0A0M4CQ92
Position
2360853..2362634
Genome map
AA seq 593 aa AA seqDB search
MHAYRTHHCGQLRSQDVGQTVRLSGWVHRKRDHGGLLFVDLRDHYGLTQIVADSSDTAFA
TLDGLRAESVVTVTGEVVARAPETINANLPTGEIEVRAREVSVQSAAAELPLPVASEQEY
PEDIRLKYRFLDLRRERLHQNILLRSNVIASLRRRMVEQGFTEYQTPILTASSPEGARDY
LVPSRVHPGKFYALPQAPQMFKQLLMVAGFDRYFQIAPCFRDEDARADRSPGEFYQLDFE
MSFVTQDDVFNAIEPVLAGVFEEFANGKSVTPAGSFPRIPYRESILKYGNDKPDLRNPLI
ISDVSAHFEGSGFGRFADIVAARDVVRAIPAPGTAEKSRKFFDDMNSWAQGEGFAGLGYA
TRKGGEWGGPIAKNHGTDKMDALAAELGLGPDDGLFFAAGKEAVAAKLAGLARTRVAEQL
ELIDTNRFAMCWIVDFPMFEADEETGKIDFSHNPFSMPQGELEALETKDPLDILAWQYDI
VCNGVELSSGAIRNHRPDIMYKAFEIAGYSQAEVDANFSGMINAFKFGAPPHGGSAPGVD
RIVMLLADEPNIREVVVFPMNQKAEDLMMGAPAPVSEKQLKELSIRLVDGPKN
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcctatcggacccaccactgcggtcagcttcgcagccaggacgtcggccagacg
gtccgcctgtcgggctgggtgcaccggaagcgcgatcacggcgggctgctcttcgtcgat
ctgcgcgaccattatggcctcacccagattgtcgctgactcaagcgacaccgcctttgcg
actctcgacggcctgcgcgccgaaagcgttgtcaccgtcaccggcgaggtcgttgcgcgt
gctccggaaacgatcaacgcgaaccttccgaccggcgagatcgaggtgcgggcccgcgaa
gtgtcggtgcagtccgcggcagccgaacttccgcttccggtcgcgagcgagcaggaatat
cccgaagatatccgcctgaaataccgctttctcgacctacgccgcgagcgcctccaccag
aatattctcctgcgctcgaacgtgatcgccagcctgcgccgccggatggtggagcagggc
tttaccgaatatcagacaccgatcctgaccgcatcgtcgcccgagggcgcgcgcgactat
ctcgtgccgagccgcgttcatcccggcaaattctatgcgctgccgcaggcgcctcaaatg
ttcaagcagctgctgatggttgcgggctttgaccgttacttccagatcgcgccgtgcttt
cgcgacgaggatgcacgcgccgaccggagcccgggtgagttctaccagctcgatttcgag
atgagcttcgtcacgcaggacgatgtcttcaacgcgatcgagccggtgcttgccggggta
tttgaggaatttgcaaacggcaagtcagtgacccccgccggctcctttccgcgcattccg
taccgcgaatcgatactgaaatatggcaatgacaagccggatcttcgcaacccgctgatc
atcagcgacgtatcggcgcattttgaaggatcaggctttggccgttttgccgatatcgtt
gcggcacgcgacgtggtgcgcgccatcccggcgccgggcaccgccgagaagagtcgcaaa
ttcttcgacgatatgaacagctgggcgcagggtgaaggctttgccggccttggatacgcg
acgcgcaagggcggcgagtggggcgggccgatcgccaagaaccacggcacggacaagatg
gacgcgctcgctgccgaactcggcctcggccccgacgatgggcttttctttgccgcgggc
aaggaagcggtcgcagcaaagcttgcaggccttgcgcgtacgcgcgttgccgaacagctc
gagctgatcgacacgaaccgctttgccatgtgctggatcgtcgatttccccatgttcgag
gccgacgaggagaccggcaagatcgacttcagccacaaccccttcagcatgccgcaggga
gagctcgaggcgcttgagaccaaggacccgctcgatatcctcgcctggcagtacgacatc
gtctgcaacggcgtcgaactgtcatcgggcgcgatccggaaccaccgtccggacatcatg
tacaaggcgttcgagatcgcgggatatagccaggccgaggtcgatgccaatttcagcggc
atgatcaacgcgttcaaatttggcgcgccgccgcacggcggttcggcgccgggggtcgat
cgcatcgtgatgcttctcgccgacgagcccaatatccgcgaggtcgtcgttttcccgatg
aaccagaaggccgaggatctgatgatgggggctccggcgccggttagcgaaaagcagctg
aaggaactcagcattcggctggttgacggacccaagaactga

DBGET integrated database retrieval system