KEGG   Sphingopyxis sp. 113P3: LH20_13650Help
Entry
LH20_13650        CDS       T04069                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00072  Synthesis and degradation of ketone bodies
sphp00280  Valine, leucine and isoleucine degradation
sphp00650  Butanoate metabolism
sphp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LH20_13650
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    LH20_13650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH20_13650
Enzymes [BR:sphp01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     LH20_13650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ALC12996
UniProt: A0A0M4CVG6
Position
2733414..2734124
Genome map
AA seq 236 aa AA seqDB search
MANKRYPDAATALEGILFDGMQICAGGFGLCGIPERLIDAIRDSGVKDLTIASNNAGVDG
EGLGKLLRTRQIRKMISSYVGENKEFERQYLAGELEVEFCPQGTLAERCRAGGAGIPGFY
TRTGVGTAVAEGKEVRSFDGEDYILERGIFADLAIIKGWKADESGNLIFRKTARNFNQPM
ATAAKICVAEVEEIVPVGSLDPDAIHLPGIYVKRLVLGAPYDKKIEFRTVRPREAA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaagcgatatcccgacgcagcgacagctcttgagggtatcctcttcgacgga
atgcagatttgcgctggtggctttggcctttgcggcatacccgagcggctgatcgacgcg
atccgggactccggggtcaaggacctcaccatcgcgagcaacaatgccggcgtcgacggc
gaagggctcggcaagctcctgcgcacgcgccagatcaggaagatgatctcctcctatgtc
ggcgagaacaaggaattcgagcggcaatatctcgcaggcgaactcgaggtcgaattctgc
ccgcagggtacgctcgcggaacgctgccgcgctggcggcgcgggtattccgggattttac
accaggaccggcgtcggcactgcggtcgccgagggcaaggaagtccgctcgttcgacggc
gaggactatatcctcgaacgcggcatctttgcagaccttgcgatcatcaagggctggaaa
gcagacgagagcgggaacctcatcttccgcaagaccgcgcgcaacttcaaccagccgatg
gcgaccgcggcgaagatctgcgtcgcagaggtcgaagagattgttcccgtcgggagcctc
gaccccgacgccattcatttgccgggcatctatgtgaagcggctcgttctcggcgcgccc
tatgacaagaagatcgagttccgcaccgtgcggccgcgggaagccgcgtga

DBGET integrated database retrieval system