KEGG   Sphingopyxis sp. 113P3: LH20_16360Help
Entry
LH20_16360        CDS       T04069                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
sphp  Sphingopyxis sp. 113P3
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH20_16360
Enzymes [BR:sphp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     LH20_16360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ALC13533
UniProt: A0A0M3QE10
Position
3316625..3318811
Genome map
AA seq 728 aa AA seqDB search
MAKKVFSAALLGGAMLALAACNASKNDSISGGGSLDEAEKASETLLKTGGTGDDWGGIGY
SYDEQRFSPLTDINDKNVGDLGIAWYADLEDARGQEATPVVVDGVLYVSHAWSKVDAWDA
ATGRKLWSFDPEVPGERAVSACCDVVNRGVAVWGDKVFVGTLDGRLIALDRKTGQQIWST
QTFDKRKPYTITGAPRVVKDMVLIGNGGAEFGVRGYVTAYDADTGKQRWRFYTVPNPDKR
ADNAASDAIFASKANATWSDEGEWKVSGGGGTVWDAIVYDKDLDQIYLGVGNGNPWNHGT
RSNGEGDNWFLSSVVALDAVTGAYKWHYQETPAETWDYTATQPIILAEQMIDGRPVKVLY
HAPKNGFFFTIDRATGTLIDAKPFVDGINWATGYDLATGRPIENPESRFYKTGKPFIAVP
GALGAHNWHPMSFNPKTGLVYIPAQQIPQGYLQDMDELDKRKVLGFNVGTSLNKTMLPDD
VAAFKAAVAATTGRLVAFDPRTGKVAWGVDYPAAWNGGTMTTAGNLVFQGTSTGRFRAYS
ADSGKQLLDLDMQSGIVSAPSTFRVGGVQHIAFQTGKGGAFPLVAGVAGGVTRKVPNLPR
LVVLKLGGTVQLPAPPATTTLAWNPPPQFGSAAQVAAGKAHYGRYCQVCHGDSAIGNGFT
PDLRVSGTLSSADAWKSVILDGALQDRGMVSFARVLTAADAEAIRSYVIDRSNWTKANLP
DASAPVGR
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaggtcttttcggcagcgctgctgggcggcgcgatgctggcgctggcggcg
tgcaacgcgtcgaagaacgacagtatctcgggcggcggttcgctcgatgaggccgaaaag
gcgagcgaaaccttgctcaagaccggcggcaccggcgacgattggggcggcatcggctat
agctatgatgaacagcgcttcagcccgctgaccgacatcaacgacaagaatgtcggcgac
ctcggaatcgcctggtacgccgatctcgaggatgcgcgcgggcaggaggcgacccccgtc
gtcgtcgatggcgtgctctacgtcagccacgcctggtcaaaggtcgatgcgtgggacgcc
gcgaccggcaggaagctgtggagctttgaccccgaggtccctggcgagcgcgcagtcagt
gcgtgctgcgacgtcgtcaatcgcggcgtcgctgtgtggggcgacaaggtctttgtcgga
acgctcgatggccgcctcatcgccctcgaccgcaagacgggtcagcaaatctggtcgacg
cagacctttgacaagcgcaagccctatacgatcaccggggccccgcgcgtcgtgaaggac
atggtgctgatcggcaatggcggcgccgaattcggggtacgcggctatgtcaccgcctat
gacgccgatacgggcaagcagcgctggcgcttctacaccgtgcccaatcccgacaagcgc
gccgacaacgccgcgagcgacgccatctttgcttcgaaagccaatgccacctggtccgac
gagggggagtggaaagtctcgggcggcggcggcacggtctgggacgcgattgtctatgac
aaggatctcgaccagatctatctgggcgtcggtaacggcaacccctggaaccacggaacg
cgctccaacggcgagggcgataactggttcctgtcctcggtcgtcgctctcgacgctgtg
accggtgcctataaatggcattatcaggaaaccccggccgaaacgtgggactataccgcg
acccagccgatcatccttgccgagcagatgatcgacggcaggccggtgaaggtcttgtac
catgcacccaagaacggcttcttcttcacgatcgaccgcgcgacgggcacgctgatcgac
gccaagcccttcgtcgacgggatcaactgggcaacgggctatgaccttgcgacgggccgt
ccgatcgaaaatcccgaatcgcgcttctacaagacgggcaagcccttcatcgccgttccg
ggcgcgctcggcgcgcacaattggcatccgatgagcttcaatccgaagacgggccttgtc
tatatcccggcgcagcagatcccgcagggctatcttcaggacatggacgagctcgacaag
cgaaaggtgctcggattcaacgtcggcacctcgctcaacaagacgatgctgcctgacgac
gtcgccgctttcaaggccgcggtcgccgcaacgacaggacgcctcgtcgccttcgacccg
cgcaccggaaaggtcgcctggggcgtcgactatccagccgcctggaacggcggcacgatg
acaacggcaggcaacctcgtcttccagggcacgagcaccggccgctttcgcgcctattcg
gccgacagcggcaagcagctcctcgacctcgacatgcagtcgggcatcgtcagcgcgccg
tcgaccttccgcgtgggcggcgttcagcatatcgccttccagaccggcaagggcggcgcc
tttccgctcgtcgcaggcgtagcgggcggggtaacgcgcaaggtgccgaacctgccgcgc
ctcgtcgtgctcaagctcggcggtaccgtgcagctccccgcgcccccggcgaccacgacg
ctcgcgtggaacccgccgccgcaattcggcagtgcggcccaggtcgcggcgggcaaggca
cactatggtcgctattgccaagtctgccatggagacagcgcgatcggcaatggcttcacg
ccagaccttcgcgtctccggcaccctctccagcgccgatgcgtggaagagcgtgatcctc
gacggcgcgctccaggatcggggcatggtcagcttcgcccgtgtcctcaccgccgccgat
gccgaggcgatccgttcctacgtcatcgaccgctcgaactggaccaaggccaatctgcca
gacgcatcggcgccggtcgggcggtaa

DBGET integrated database retrieval system