KEGG   Sphingopyxis sp. 113P3: LH20_17920
Entry
LH20_17920        CDS       T04069                                 

Definition
(GenBank) phosphomevalonate kinase
Organism
sphp  Sphingopyxis sp. 113P3
SSDB
Motif
Pfam: LPD22 MuF_C DprA_WH
Other DBs
NCBI-ProteinID: ALC13838
UniProt: A0A0M4CXX7
Position
3625395..3632075
AA seq 2226 aa
MAPPLPGLDYYDQRFRSRPANEPVARIDPIEAEMRRERDRQTRLDLLLSASPDTVGRATT
IAKEIGVPPMHVEDRLAEAEKGRHVRRFMSVAERYPAIGKWAVTQPRGAAAASDDWDSLS
LLGKTWRSTREVATGIFPSLSSGLFTMAENVEGAIGAVSDTLDAIDPMPAVAGIFSDLIG
TYTGYNPRWDKSFAANQRIQREARAKRQAELAREAEDWRPKSTSWIARELLAGTESIPMS
AAALITRDPKQAAGVFGTLTGAGEYQKARDAGLDLGSSLAYGARQGAVEALTEHIPAAKL
LGDIAARSPLGKMLLNQLVREVPGEQVATLLQDFDQWVTLNPDKTLGEFIAERPDAARQT
LLGTIGAVGTTTAVVRATQKVAEGSAMIAARRGEADRALREGDILAKAGAAAEKSKLRER
DPEAFAALMRELAEDSGATDVYIPAEAIQQYMQSDGFDPDSWAEFEEESLEAMATGGDVV
MPVERVLTAFPGTPAWEALRDHMRLSPGGMSRFEAESFNLEVAELRQTMEEQAAAVEEYD
REMMEAREALLTDVTEKLQTAGYTPSVARTQAELLAARYETRAMRKGQRLTGREFADVDV
VQILPEKLALRQKNDGLDRVIDAMRRGTEGAKRGPSLLEFISKRGGIDDVGGDIASMGGD
KWHRSAPFRKRLTRSVDKGQASMLSAAASDTAPEDVFRAAISAGYFPELAGREEGTYDDA
LDNRMLLDAIGEELRGNARYAEEVDTTLTDAAQELATLLANEGLDPASATRKQIRDAIAA
YSARNANEGRGYLQAGLRDDIQAAWSGTKTRGFIDLGPVPQALVDFGLPAGKLQIGRGKI
NAIANKHDLEVGDVASLAAMLEQPWAIYPTTLKDSNRVVVALPVRDRNGDPILCVIEPNG
KVATVTSVYGKKGRGSVTGDDTIRAAIANARAKGLEVFEGAPPARDPEPVSGIMPEKRRR
PILSLPQNGKPTSLEQSGDEKAPRGRIVFPSEEFTGAALIELFKSRNLSTFLHETGHLWL
EELRYDALSEDATNRLKDDWATVQDWFAANGHPIENGVIPVEAHEMWARGVEQYLMEGKA
PVPALRSIFEQFRAWLTSIYRSVKALRSPLTPEIRRVMDRLIATDDDIALASREQSVQPL
LTDGTDMTKAEWEAYQRLTADARIEARGQLLDKTVRDVRARNTKKYREMAAELREEIEAS
VDERPAFRAIAAMRAQPIDRRWVVNMMGEEAAAYMPRGVPPLMRNGGVHPDTIAEQSGFA
TAYEMIEALTELEIAHRTAREEGDQRGLRERIIEEELDIMMRDRYGEPLTDGSIEREAIA
AVHNDLQGEVIAAEVRVLGRKAGEPPTPYSAAQEWARQKIRSGKVSVEAMPGALQRYARA
SKRAAREAEAAYLERNIEGAFRAKQQQMLNNALYSEAKKAHEEVEAARQRLNKIASKRVM
KSVDQEYLEQAQALLEAVDIKRRTQKGITRQGKWEEWSQQRQAEGYDIVVPSSFEATIGK
ENWTRLTVEHFLGLDEAVRQIIHLGRLKRELQDGQDKREFELTVTQAVQAVAKLPQRPPS
DLMEPSRWDAIKSKVAAADAALLKMETVFDWLDSGDSNGIFNRIVFRPLVDAQENERIRM
NDILGQLRAALEKVPADTLKRWSDKITAPELINRETGNPFVMTREMVIAIALNTGNSGNY
EKLLGGYGWSATGVEAMLARVMTQEEWAYVQEVWDIINSLWPDIEAMEKRVNDIAPEKVE
ARPVQTKWGVLKGGYYPVVYDPRRNYESESYAAKGDSLFEGIYTRATTPKGFTKERTNVE
RPIHLSLGVIHRHVGEVIHDLTHREAIMQADKFLQARPVMKAVDDSLGPEVRKQFRPWLQ
RIANEWAYDRAGQAGVEGFVKKARLNATIVGMGFRATTILLQAAGYSNSFETVGLRWVSR
RLKDVGNPEAWNFVLEKSKEVRARMDTLDRDIRDNVRKAAGQRNLSAIKKFAFHGIGYMD
RVVVIPTWLGAYDKAIAEGMSEDDAVYAADKAVRQSQGAGAAKDLAAIQSGRGTFGEAAK
LLTMFYSYMSAFYQRQRSFARDVRAAKLSDGPGLLARAWWLFIVPPLLSELLAGRTPDDD
DDESWAEWALSNIIFQIFGPVPVLRDIGPTLWAKATDRPTFGYRFTPAQGGVESIINVGS
DLGKIWRGEETKRATRNAIETTGYFTGLTTGQMAVAAQFLVDVGSGDANPDGIGEWWRGL
TTGKTD
NT seq 6681 nt   +upstreamnt  +downstreamnt
atggccccacctcttcccggtctcgattattacgaccagcgctttcgcagccggccggcc
aatgagcctgtcgcgcgcattgatccgatcgaagcggagatgcgccgcgagcgcgatcgc
cagacgcgtctggatctcctgctttctgccagccccgacacagtaggccgcgcgaccacg
atcgcgaaggagatcggcgtcccgccgatgcacgtcgaagatcggcttgcggaggccgag
aaggggcgccatgtgcgccggttcatgtcggtggcggagcgctatcctgcgatcggcaaa
tgggcggtgacgcagccgcgcggcgctgccgcggcgtctgacgactgggatagcctgtcg
ctgctcggaaagacctggcgcagcactcgtgaggtcgcgaccggcattttcccgtcgctg
tcgtctggcctcttcacgatggctgagaatgtcgaaggtgcgatcggcgcggtgtcggac
acgcttgacgcgatcgaccctatgccggccgtcgcgggcatcttcagcgatctcatcggg
acctataccggttataatccgcgttgggacaagagctttgcagccaaccagcgcattcag
cgcgaggcgcgggcgaagcggcaggccgagctcgcgcgggaagccgaagactggcgtccg
aagtcgaccagctggatcgctcgcgagctcctggccggcaccgaatctatcccgatgtcc
gccgcggcgctcatcacccgcgatccgaagcaggcggccggcgtcttcgggacgctcacc
ggcgccggcgagtatcagaaggcgcgcgatgcgggcctcgatctgggctcttcgcttgcc
tacggcgcccggcagggcgcggtcgaggcgctgaccgagcatatcccggccgcaaagctg
ctgggcgatatcgcagcgcgctcgccgctggggaagatgctcctcaaccagctggtgcgc
gaagtgccaggcgagcaagtcgcgacgctgctccaggatttcgaccagtgggtcacgctc
aaccccgacaagacacttggcgaattcattgccgagcggcccgatgccgcgcggcagaca
ctcctcggaacaatcggcgcggtcggcacaacgacggcggtggtgcgcgcgacgcagaag
gtagcggaaggatccgcgatgatcgcggcgcgccgcggcgaggctgaccgcgcgctgcgc
gagggcgacattcttgcgaaggcgggcgctgcggcggaaaagtcgaaactgcgcgagcgc
gatcctgaagccttcgctgcgctgatgcgcgagctcgcggaggatagcggcgccaccgac
gtctatattccggccgaagcgatccagcagtatatgcaatcggacgggtttgatcccgac
agctgggccgaattcgaggaggaatcgctcgaggcgatggcgacgggcggcgatgtcgtc
atgccggtcgagcgcgtgctgacggcgttcccaggcacgccggcatgggaggcgctgcgc
gatcatatgcgcctcagccctggcggcatgtcgcgcttcgaggcggagagcttcaacctc
gaggtcgccgagctccgccagacgatggaagagcaggccgcggcggtcgaggaatatgac
cgcgagatgatggaggcgcgtgaggcgctgctcaccgacgtcaccgaaaagctacagacg
gccggatatacgccttcggtggcgcggacgcaggcggagctcctcgcggcgcgctatgag
acgcgcgcgatgcgcaaggggcagcggctcaccggccgggaattcgcggacgtcgatgtc
gtccagatcctgcccgagaagctggcgctgcggcagaagaatgacgggctcgaccgggtc
attgacgcaatgcggcgcgggaccgagggggcaaagcgcggcccgtcgctcctggaattc
atctcgaagcgaggcggcatcgacgatgtcggcggggatatcgcgtccatgggcggcgac
aagtggcaccgcagcgcgcccttccgcaagcggctgacgcgcagcgtcgacaagggccag
gcaagcatgctgagtgcggctgccagcgacacggcgcccgaggacgtcttccgcgccgcg
atcagtgccggctatttcccggagctcgcggggcgcgaagagggcacctatgatgatgcg
ctcgacaatcggatgctcctggatgcgatcggcgaggagctccgcggcaatgcgcgctat
gccgaagaagtcgacacgacgctgacagacgcggcgcaggagctcgccaccctgctcgcc
aatgagggtctcgatccggcgtcggcgacaaggaagcagatccgcgacgcgatcgcagcc
tattcggcgcgaaacgcgaacgaagggcgcggctatttgcaggcgggccttcgtgacgat
atccaggcggcatggagcggcaccaagacgcgcggcttcatcgacctggggccggtgccg
caagcgctggtggatttcggtctcccggccgggaagctgcaaatcggccgcggcaagatc
aacgcgatcgccaacaagcatgacctcgaggtcggcgatgtcgcgagccttgcggcgatg
ctcgagcagccctgggcgatctaccccacgacgctcaaggattcgaaccgcgttgtcgtc
gcgctccccgtgcgcgaccgcaatggcgatccgatcctgtgcgtcatcgagccgaacggc
aaggtggcgacggtcaccagcgtctatgggaagaagggtcgcggcagcgtcacgggcgat
gacacgatccgagccgcgatcgccaacgcgcgcgcgaagggtctcgaggtgttcgagggt
gctcctccggcgcgtgatcccgaaccagtatcgggcattatgccggagaagcgacgtcga
cctatactgtcgctgccccaaaatggcaaaccgaccagcctcgagcagagcggtgacgag
aaggcgccgcgcgggcgcatcgtgtttcctagcgaggagttcacgggcgctgcgctgatc
gagcttttcaagtcccgcaacctctccaccttcctccatgaaaccgggcacctgtggctc
gaggagctccgctacgatgccctctccgaggacgcgaccaaccgtctcaaggacgattgg
gcgacggtgcaggactggttcgccgccaacggccatccgattgagaatggcgtgatcccg
gtcgaggcgcacgaaatgtgggcgcggggcgtcgagcagtatctcatggagggcaaggcg
ccggtccctgccctgcgcagcatcttcgagcagttccgcgcctggctgaccagcatctat
cgcagcgtgaaggccctgcgctcgccgctgacgccggagatccgccgcgtcatggaccgg
cttatcgcgaccgacgacgatatcgcgctcgccagccgcgagcagtcggtgcagccgctg
ctgaccgatggcaccgacatgacaaaggcggaatgggaggcctatcagcgtctcaccgcc
gacgcgcgaatcgaagcccgcgggcagttgctcgacaaaactgtgcgcgacgtgcgcgcg
cgcaacacaaagaagtaccgcgagatggcggcggagcttcgcgaagagatcgaggccagc
gtcgacgagcggcccgcgttccgtgctattgccgcgatgcgcgcgcagcccattgatcgg
cgctgggtggtcaacatgatgggcgaagaggccgcggcgtacatgccgcgcggagtgccg
ccgctcatgcgcaacggcggcgtgcatcccgacacgatcgcagagcagtcggggttcgca
accgcctacgaaatgatcgaggcgctgaccgagctcgagatcgcgcatcgcaccgcccgc
gaagagggagaccagcgcgggctgcgagagcggatcatcgaggaagagctcgatatcatg
atgcgcgaccggtacggcgagcccctcaccgatggcagcattgaacgtgaagcgatcgcc
gcggtgcataatgacctgcaaggtgaggtcatagcggcggaagtgcgcgtgctcggccgg
aaggcgggcgagcccccgacgccctactcggcggcgcaggagtgggcgcggcagaagatc
cggagcggcaaggtcagcgtcgaagccatgccgggcgcgctacaacgctatgccagggcg
tcgaagcgcgcggcccgggaggccgaggcggcctatctcgagcgcaatatcgaaggcgca
ttccgcgcgaaacagcaacagatgctcaacaatgcgctctattccgaggcgaagaaagcg
cacgaagaggtcgaggcggcgcgccagcggctcaacaagatcgcgtcgaagcgcgtcatg
aagtctgtcgaccaggaatatctggaacaagcgcaggcgctcctcgaggcggtcgacatc
aagcgccgcacgcagaagggcatcactcgccagggcaagtgggaagagtggtctcagcag
cgccaggctgaaggatatgacatcgttgtgccctcatccttcgaggcgacgatcggcaag
gaaaactggacccggctcacggtcgagcatttcctcgggctcgatgaagcggtgcgccag
attatccacctcggccgcctgaagcgcgaattgcaggacgggcaggacaagcgcgaattc
gagctcaccgtcacccaggcggtgcaggccgtggccaagctgccgcagcgcccgccgagc
gatctcatggagccctcgcgctgggacgcgatcaagtcgaaggtcgcggctgccgatgcg
gcgctgctcaagatggaaaccgtcttcgactggctcgacagcggcgacagcaacggcatc
tttaaccggattgtcttccggccgctcgtcgatgcacaggagaatgagcggatccggatg
aacgatattctcggccagctgcgcgccgcgctcgaaaaggtgccggccgacacgctcaag
cgctggtcggacaagatcacggcgcccgagctcatcaaccgcgagaccggcaatcccttc
gtcatgacgcgcgagatggtcatcgcgatcgcgctcaacactggcaacagcggcaactat
gaaaagctgctcggcggctatggctggtcggcgacgggcgtcgaggcgatgctcgcccgc
gtgatgacccaggaggaatgggcctatgtccaggaggtctgggacatcatcaacagcctt
tggcccgacatcgaggcgatggaaaagcgcgtcaacgatatcgccccggagaaggtcgag
gcccggccggtgcagacaaaatggggcgtgctgaagggcggctattatcccgtcgtctac
gatccgcggcgcaactacgaatcggaaagctatgccgccaaaggcgacagccttttcgag
ggcatctatacgcgcgccacaacgcccaaggggttcacgaaagagcgcaccaacgtcgag
cggccgatccatctgagcctgggcgtcatccatcgccatgtgggcgaggtcatccatgac
ctgacgcaccgcgaggcgatcatgcaggcggacaagttcttgcaggcacgcccggtgatg
aaggcggtggacgatagtctcgggcccgaggtgcgcaaacagttccgcccctggcttcag
cgtatcgccaatgaatgggcctatgaccgcgcggggcaggctggggtggagggcttcgta
aagaaggcgcgcctcaacgcgacgatcgttggcatggggttccgcgccacgacgatcctg
ctccaagctgcgggctattcgaacagctttgagacggtgggcctgcgctgggtgtctcgg
cgcctcaaggacgtcggcaatcccgaggcgtggaattttgtgctcgagaagtcgaaggaa
gtccgggcccgcatggacacgctcgatcgcgatatccgcgacaatgtccgcaaggccgcg
ggtcagcgcaatttgagcgcgatcaagaaattcgcgttccacggcatcggctatatggac
cgcgtcgtcgtcatcccgacctggctgggcgcctatgacaaggcgatcgcggagggcatg
tcggaggatgacgcggtctacgccgccgacaaggcggtccggcagtcccagggcgccggc
gccgccaaggatctcgccgcgatccagtccgggcggggtacgttcggagaggcggcgaag
ctgctcaccatgttctacagctacatgtcggccttctatcagcgccagcgcagctttgcg
cgcgacgtgcgcgcggcgaagctctccgatggaccaggtctgctcgcgcgtgcttggtgg
ctcttcatcgtccctcccctgctttccgagctcctcgccggccggacgccggatgatgac
gatgatgaaagctgggcggagtgggcgctctcgaatatcatcttccagatcttcgggcct
gtcccggtgctgcgcgatatcggtccgacgctctgggcgaaggcaaccgaccggcccaca
ttcgggtaccggttcacgccggcgcagggcggtgtcgagagcatcatcaatgtcggctcg
gacctgggaaagatctggcgcggcgaagagacgaagcgcgcgacgcgcaacgcgatcgaa
acgacgggctatttcaccgggcttaccacggggcagatggcggttgcggcgcagttcctg
gtcgatgtgggctcgggcgatgcgaatccggacggcatcggcgagtggtggcgcgggctc
acgacaggcaagacagactag

DBGET integrated database retrieval system