KEGG   Sphingopyxis sp. 113P3: LH20_18655Help
Entry
LH20_18655        CDS       T04069                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00010  Glycolysis / Gluconeogenesis
sphp00071  Fatty acid degradation
sphp00350  Tyrosine metabolism
sphp00625  Chloroalkane and chloroalkene degradation
sphp00626  Naphthalene degradation
sphp00680  Methane metabolism
sphp01100  Metabolic pathways
sphp01110  Biosynthesis of secondary metabolites
sphp01120  Microbial metabolism in diverse environments
sphp01130  Biosynthesis of antibiotics
sphp01200  Carbon metabolism
sphp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LH20_18655
  09102 Energy metabolism
   00680 Methane metabolism
    LH20_18655
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH20_18655
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LH20_18655
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LH20_18655
   00626 Naphthalene degradation
    LH20_18655
Enzymes [BR:sphp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LH20_18655
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     LH20_18655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C Sacchrp_dh_NADP AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALC13983
UniProt: A0A0M3QEA0
Position
3782060..3783151
Genome map
AA seq 363 aa AA seqDB search
MTKAAVLIEPGKPLAIEEVVVDKPGPHEVRIRTAACGLCHSDLHFIEGAYPHPLPAIPGH
EAAGIVEAVGSEVRTVKPGDAVITCLSAFCGHCEFCVSGRMSLCMGGDTRRPAGSAPRIT
RPDGSPVNQMLNLSAFSEVMLVHEHACVAIDPDMPLDRAAVIGCAVTTGAGTIFNACKVT
PGETVAVVGCGGVGLATINAAKIAGAGRIIAADPVPEKRALAQKLGATDVVDALADDAAK
QIVEISKGGVDHAIEAVGRPASANLAVAALRRGGTATILGMMPLSEKVGLGAMDLLSGKK
LQGAIMGGNRFPVDIPRLVDFYLRGLLDLDSIVAETIPLSQINEGFDKMKKGDAARSVIV
FDQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagccgccgtcctgatcgaacctggcaagccgctcgccatcgaagaggtcgtc
gtcgacaagcccgggccgcatgaggtgcgcatccgcaccgccgcgtgcgggctctgccat
tcggacctgcatttcatcgagggcgcctacccgcacccccttcccgccatccccggccac
gaggccgcaggcattgtcgaggcggtcggcagcgaggtgcgcaccgtgaaaccgggcgat
gcggtgatcacgtgcctttctgccttctgcggccactgcgagttctgcgtctccgggcgc
atgtcgctgtgcatgggcggcgatacccggcggccggcgggttcggcgccacggatcacc
cggccggacggatcgcccgtcaaccagatgctgaacctcagcgccttttcggaggtgatg
ctcgttcacgaacatgcctgcgtcgcgattgaccccgacatgccgctcgaccgcgccgcg
gtgatcggctgcgcggtgaccaccggcgcgggaacgattttcaacgcctgcaaggtgacg
ccgggcgaaacggtcgcggtcgtcggctgcggcggcgtggggctcgcgacaatcaacgcg
gcgaagatcgccggcgcggggcgcatcatcgccgccgatccggtgcctgagaagcgtgcc
ctcgcgcaaaagctgggcgcgaccgacgtcgtcgacgccctcgccgacgatgccgcgaag
cagatcgtcgaaatttcgaagggcggtgtcgaccatgcgatcgaggcggtcggacgcccc
gcctcggcgaaccttgccgtcgcggcgcttcgccgcggcggcaccgcgacgatccttggc
atgatgccgctttcggaaaaggtcgggctcggcgccatggacctgctctcgggcaagaaa
ttgcagggcgcgatcatgggcggcaaccgattcccggtggatattccgcggctcgtcgat
ttctacctgcgcgggctgctcgacctcgacagcatcgtcgcggaaaccatcccgctgtca
cagatcaacgaagggttcgacaagatgaagaagggcgacgccgcgcgatcggtgatcgta
ttcgaccaatga

DBGET integrated database retrieval system