KEGG   Sphingopyxis sp. 113P3: LH20_22115Help
Entry
LH20_22115        CDS       T04069                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp00071  Fatty acid degradation
sphp00072  Synthesis and degradation of ketone bodies
sphp00280  Valine, leucine and isoleucine degradation
sphp00310  Lysine degradation
sphp00362  Benzoate degradation
sphp00380  Tryptophan metabolism
sphp00620  Pyruvate metabolism
sphp00630  Glyoxylate and dicarboxylate metabolism
sphp00640  Propanoate metabolism
sphp00650  Butanoate metabolism
sphp00900  Terpenoid backbone biosynthesis
sphp01100  Metabolic pathways
sphp01110  Biosynthesis of secondary metabolites
sphp01120  Microbial metabolism in diverse environments
sphp01130  Biosynthesis of antibiotics
sphp01200  Carbon metabolism
sphp01212  Fatty acid metabolism
sphp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH20_22115
   00630 Glyoxylate and dicarboxylate metabolism
    LH20_22115
   00640 Propanoate metabolism
    LH20_22115
   00650 Butanoate metabolism
    LH20_22115
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH20_22115
   00072 Synthesis and degradation of ketone bodies
    LH20_22115
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH20_22115
   00310 Lysine degradation
    LH20_22115
   00380 Tryptophan metabolism
    LH20_22115
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH20_22115
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH20_22115
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH20_22115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphp04147]
    LH20_22115
Enzymes [BR:sphp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH20_22115
Exosome [BR:sphp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH20_22115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALC14666
UniProt: A0A0M4CTN4
Position
unnamed:complement(75772..76971)
Genome map
AA seq 399 aa AA seqDB search
MREVAIVSTARTPIGKAYRGAFNDTQGQALAGHAVREAVTRAGVEPGEVEDVVLGCAMQQ
GSTGFNVARQAALWAGLPDGIPGMTMDRQCGSGLMAIAACANRIMTGEIDVAVGGGVESI
SLVQNQHMNHYRAGDPRLIETKPAIYMAMIETAEIVAERYGVSREAQDTYALQSQQRTAQ
AQEEGRFNAEIAPMTSTMVVTDRESGATTKREVTLDRDEGNRPQTRLEDLQKLAPVFKDG
QQIKQGQYITAGNASQLSDGAAALVLMEAAEAKRRGLEPLGVYRGLAVAGCAPEEMGIGP
VFAVPKLLEKHGLSVDDIGIWELNEAFASQVIYCRDRLGIPDERLNVSGGAISIGHPYGM
SGARMTGHLLIEGRRRGAKYGVVTMCIGGGMGAAGLFEL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggtcgcaatcgtcagcaccgcccgcaccccgatcggcaaggcctatcgtggg
gcgttcaacgatacgcagggacaggctctggcaggccacgcggtgcgcgaggcggttact
cgcgcgggcgtggagcccggcgaagtcgaggacgtggtgctcggctgcgcgatgcagcag
ggctcgaccggcttcaacgtcgcgcgccaggcggcgctgtgggcggggctgcccgacggc
attccgggaatgaccatggaccgccagtgcggctcgggcctgatggcgatcgccgcttgc
gccaaccgcataatgacgggggaaatcgacgtggccgtcggcggcggggtcgaatcgatc
agcctcgtgcagaaccagcatatgaaccattatcgcgccggcgatccgcggctcatcgaa
acgaagcccgcgatctatatggcgatgatcgagaccgcggagatcgtcgccgagcgctac
ggcgtcagccgcgaagcgcaggacacatacgcgttgcagtcgcagcagcgcacggcgcaa
gcgcaggaagaaggccgcttcaacgccgagatcgcgcccatgacctcgacgatggtggtg
accgatcgcgagagcggcgcgaccaccaagcgcgaggttaccctcgaccgcgacgagggc
aaccggccgcagactcggctcgaggacctgcaaaagctggcgccggtgttcaaggacggg
cagcagatcaagcagggtcagtacatcaccgcgggcaacgcgtcgcagctatccgacggc
gccgccgcgttggtattaatggaggccgcagaggcgaagcggcgcggcctcgagccgctc
ggtgtctatcgcggcctcgcggtcgcgggctgcgccccggaagagatgggcatcggacct
gtgttcgcggtgccgaagctgctggaaaagcatggactgagcgttgatgacatcggcatc
tgggagctcaacgaagcgttcgcgagccaggtcatctattgccgtgaccggctcggcatc
ccagacgagcgcctgaacgtcagcggcggggcgatttcgatcgggcacccgtatggtatg
tccggagcccgcatgacaggacacctgctgattgagggccggcgccgcggcgccaagtac
ggcgtagtcactatgtgcattggtgggggaatgggggctgcgggtctgtttgaactctga

DBGET integrated database retrieval system