KEGG   Sphingopyxis sp. QXT-31: BWQ93_04385Help
Entry
BWQ93_04385       CDS       T04913                                 

Definition
(GenBank) hypothetical protein
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
sphq  Sphingopyxis sp. QXT-31
Pathway
sphq00051  Fructose and mannose metabolism
sphq00520  Amino sugar and nucleotide sugar metabolism
sphq01100  Metabolic pathways
sphq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BWQ93_04385
   00520 Amino sugar and nucleotide sugar metabolism
    BWQ93_04385
Enzymes [BR:sphq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BWQ93_04385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: APZ97809
UniProt: A0A1P8WUR8
Position
complement(896303..897337)
Genome map
AA seq 344 aa AA seqDB search
MTLQIQPVILCGGAGTRLWPESRGTRAKQFLPLTGADSLFRQTVARTPPGEHFLPPVILC
GDGHLATVREQMGAREAELLVEPMPRNTAAAIALAVARADADTLLLVMPSDHVIADVPAF
HAAIGRAARLAQQDWLVTFGITPEHPETGFGYIASGDALGDDGFAVARFVEKPPLAEAEA
MLAAGGYSWNAGIFLFRAGRMRDAMLTHCRAIFEAANEAIAAGMRDGDALHADAIAFEKA
PSDSIDYAVMEKDDRVAVVPVAMGWSDLGSWQAVHALAACDEIGNATHGDVFLHDSHGNL
IRAGGKRVSVIGMEGVAVIVDGDDILVMPLKRCQDVRAAAKARE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccagatccaacctgtcatcctgtgcggcggcgcgggaacgcgcctgtggccc
gaatcgcgcggcacgcgtgcgaagcagttcctgccgctgaccggcgccgacagcctgttc
cgccagaccgtcgcgcgcaccccgccgggcgagcatttcctgccgcccgtcatcctctgc
ggcgacggccatctcgcgaccgtgcgcgagcagatgggggcgcgtgaggccgagctgctg
gtcgagccgatgccgcgcaacaccgccgcggcgattgcgctcgcggtcgcgcgggccgat
gccgacacactgctgctggtgatgcccagcgatcatgtcatcgccgacgtcccggccttc
cacgccgcgatcggccgcgccgcgcggctggcgcagcaggactggctcgtcaccttcggc
atcacccccgagcatcccgagaccggcttcggctatatcgccagcggcgacgcgctcggc
gacgacgggtttgcggtcgcgcgcttcgtcgaaaaaccaccgctcgccgaggccgaggcg
atgctcgccgcgggcggctacagctggaatgccggcatcttcctgttccgcgccgggcgc
atgcgcgatgcgatgttgacccattgccgcgcaatcttcgaagccgccaacgaggcgatc
gccgcgggcatgcgcgacggcgacgcgctccacgccgacgcgatcgcattcgaaaaggcg
ccgtcggactcgatcgactatgcggtgatggaaaaggacgaccgcgtcgcggtggtcccc
gtcgcgatgggatggtccgacctcggcagctggcaggcggtgcacgcgctcgccgcctgc
gacgagatcggcaatgcgacgcacggcgacgtcttcctccacgacagccacggcaacctc
atccgcgccggcggcaagcgcgtgtcggtgatcggcatggagggggtcgcggtaatcgtc
gacggcgacgacatcctcgtcatgccgctgaaacgctgccaggacgtccgcgccgccgcg
aaagcgcgcgaatag

DBGET integrated database retrieval system