KEGG   Sphingopyxis sp. QXT-31: BWQ93_06280Help
Entry
BWQ93_06280       CDS       T04913                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
sphq  Sphingopyxis sp. QXT-31
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BWQ93_06280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: APZ98127
UniProt: A0A1P8WVN0
Position
complement(1272407..1272808)
Genome map
AA seq 133 aa AA seqDB search
MIDSFFPYAETTGSVTVRVAVSYLPEQSHPSLGRWFWAYHVRIENHGDGAVQLINRHWRI
VDGHGQVSEVEGEGVVGEQPLIQPGGAFDYVSGCPLPTPEGSMIGSYDMEAADGSHMLVA
IPHFLLKMPATAS
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgatcgactccttcttcccttatgccgagacgaccgggtcggtcacggtgcgcgtcgct
gtcagctatctgcccgaacagtcgcacccgtcgctggggcgctggttctgggcctatcat
gtgcgcatcgaaaatcatggcgacggcgcggtccagctgatcaaccgccactggcgcatc
gtcgatggccacggccaggtcagcgaggtcgagggcgagggcgtcgtcggcgaacagccg
ctgatccagcccggcggtgccttcgactatgtctcgggctgcccgctgccaactcccgaa
ggctcgatgatcggcagctacgatatggaggcggccgacggctcgcacatgctcgtggcc
atcccgcatttcctcctgaagatgccagcgaccgcctcatga

DBGET integrated database retrieval system