KEGG   Sphingopyxis sp. QXT-31: BWQ93_11985Help
Entry
BWQ93_11985       CDS       T04913                                 

Definition
(GenBank) thiamine biosynthesis protein ThiJ
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
sphq  Sphingopyxis sp. QXT-31
Pathway
sphq00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:sphq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BWQ93_11985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sphq01002]
    BWQ93_11985
Enzymes [BR:sphq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     BWQ93_11985
Peptidases [BR:sphq01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   BWQ93_11985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase_3
Motif
Other DBs
NCBI-ProteinID: APZ99131
UniProt: A0A1P8WYK4
Position
complement(2500617..2501297)
Genome map
AA seq 226 aa AA seqDB search
MTDPAATQIVFLLFPGITQLDFTAPAQALCRMPGALLAGAAKSLDPIATDSGFSILPTHD
FASSPQADILCIPGGHGVAEALHDAATIDFIARQAAGATWVTSVCTGAFLLGRAGLLTGK
RATTHWGYTHLLPLVGATYEHARIVEDGTIVTSGGVTSGLDFALTLIASIRGDAAAQAIQ
LAIEYDPAPPFVGGHPDHAPAAVTEGLKARVYDGAAARMAAALTAP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccccgccgcaacccagatcgtcttcctgctgttcccgggcatcacccagctc
gacttcaccgcgcccgcgcaggcgctgtgccggatgcccggcgcgttgctcgcgggcgcc
gcgaagtcactcgatccgatcgccaccgacagcggcttttcgatcctgccgacgcatgat
tttgcgtcgtctccgcaggccgacatattgtgcatccccggcggccatggtgtcgccgaa
gcgctgcacgatgccgccacgatcgattttatcgcgcggcaggcggcgggcgcgacgtgg
gtgacgagcgtgtgcaccggcgccttcctgcttggccgcgccgggctgttgacgggcaag
cgcgcgacgacgcattggggctatacgcatctgctgccgctggtcggcgcgacctacgag
catgcgcggatcgtcgaggacgggacgatcgtgaccagcggtggggtgacctcggggctc
gatttcgcgctgacgctgatcgcgagcatccgcggcgacgcggcggcgcaggcgattcag
ctcgcgatcgaatatgaccccgcgccgcctttcgtcggcggccatcccgaccatgcccct
gcggcggtgaccgaagggctgaaggcgcgcgtctatgacggggcggcggcgcggatggcg
gcggcgctgaccgcgccctag

DBGET integrated database retrieval system