KEGG   Sphingopyxis sp. QXT-31: BWQ93_14320Help
Entry
BWQ93_14320       CDS       T04913                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphq  Sphingopyxis sp. QXT-31
Pathway
sphq00071  Fatty acid degradation
sphq00072  Synthesis and degradation of ketone bodies
sphq00280  Valine, leucine and isoleucine degradation
sphq00310  Lysine degradation
sphq00362  Benzoate degradation
sphq00380  Tryptophan metabolism
sphq00620  Pyruvate metabolism
sphq00630  Glyoxylate and dicarboxylate metabolism
sphq00640  Propanoate metabolism
sphq00650  Butanoate metabolism
sphq00900  Terpenoid backbone biosynthesis
sphq01100  Metabolic pathways
sphq01110  Biosynthesis of secondary metabolites
sphq01120  Microbial metabolism in diverse environments
sphq01130  Biosynthesis of antibiotics
sphq01200  Carbon metabolism
sphq01212  Fatty acid metabolism
sphq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BWQ93_14320
   00630 Glyoxylate and dicarboxylate metabolism
    BWQ93_14320
   00640 Propanoate metabolism
    BWQ93_14320
   00650 Butanoate metabolism
    BWQ93_14320
  Lipid metabolism
   00071 Fatty acid degradation
    BWQ93_14320
   00072 Synthesis and degradation of ketone bodies
    BWQ93_14320
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BWQ93_14320
   00310 Lysine degradation
    BWQ93_14320
   00380 Tryptophan metabolism
    BWQ93_14320
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BWQ93_14320
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BWQ93_14320
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BWQ93_14320
Enzymes [BR:sphq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BWQ93_14320
Exosome [BR:sphq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BWQ93_14320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APZ99527
UniProt: A0A1P8WZN9
Position
2970172..2971341
Genome map
AA seq 389 aa AA seqDB search
MPHAYIVDAVRTAGGKRGGRLAGVHPVDLGAAVFDAIADRNDFDTSKIDDVITGCVSQGG
QQTMDVGRNAVLASKLPDSIPAVTIDRQCGSSQQAIQFAAQAVMSGTQDIVLASGIESMT
RVPMGSVATLFMKEGLGHYKSERLEEKYPGIMFSQFAGAEMIVKKHGLTKDDLDAYALES
HRRGKAATEAGHFKREIVGVEIDTPEGRQLHLVDEGIRFDATLDGIAGVKILQEGGSITA
ATSSQICDGASAALVVSEQALKDHNLTPRARIHHISVTAGDPVIMLEEPLFATERALKRA
GMKIEDIDAYEVNEAFAPVPLAWLKYLGADHGRLNQHGGAIALGHPLGASGTKLMATLLG
VLDATGGKYGLQTMCEGGGQANVTIVERL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccccatgcctatatcgtcgacgccgtccgcaccgccggcggcaagcgcggcggccgc
ctcgccggcgtccaccccgtcgacctcggcgccgcagtgttcgacgcgatcgccgaccgc
aacgatttcgacacctcgaagatcgacgacgtcatcaccggctgcgtgtcgcagggcggc
cagcagacgatggacgtcgggcgcaacgcggtgcttgcctcgaagctgcccgactcgatc
cccgcggtcaccatcgaccgtcagtgcggctcgtcgcagcaggcgatccagttcgccgcg
caggcggtgatgtcgggcacgcaggacatcgtgctcgccagcggcatcgagagcatgacg
cgcgtgccgatgggcagcgtcgcgaccctgttcatgaaggaagggctcggccattataag
tccgagcggctcgaggaaaaatatcccggcatcatgttcagccagttcgccggcgccgaa
atgatcgtcaagaagcacgggctgaccaaggacgacctcgacgcctatgcactcgaaagc
caccgtcgcggcaaggcggcgaccgaggccggccatttcaagcgcgagatcgtcggcgtc
gagatcgatacgccggaaggccgccagctccacctcgtcgacgagggcatccgcttcgac
gcgacgctcgacggcatcgccggcgtgaagatcctgcaggaaggcggctcgatcaccgca
gcgacgtcaagccagatctgcgacggtgcgtccgccgcgctcgtcgtgtcggaacaggcg
ctcaaggatcacaatctgaccccgcgcgcgcgcatccaccatatctcggtgaccgcgggc
gacccggtgatcatgctcgaggaaccactcttcgcgaccgaacgcgcgctcaagagggcg
ggcatgaagatcgaggatatcgacgcctatgaggtcaacgaagccttcgcaccggtgccg
ctcgcctggctcaaatatctcggcgccgaccatggccgcctcaaccagcatggcggcgcg
atcgcgctcggccacccgctcggcgccagcggcaccaagctgatggcgacgctgctcggc
gtgctcgacgcgaccggcggcaaatacggcctgcagacgatgtgcgaaggcggcggccag
gccaacgtcacgatcgtcgaacggctgtaa

DBGET integrated database retrieval system