KEGG   Sphingobium sp. RAC03: BSY17_3844Help
Entry
BSY17_3844        CDS       T04461                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphr  Sphingobium sp. RAC03
Pathway
sphr00071  Fatty acid degradation
sphr00072  Synthesis and degradation of ketone bodies
sphr00280  Valine, leucine and isoleucine degradation
sphr00310  Lysine degradation
sphr00362  Benzoate degradation
sphr00380  Tryptophan metabolism
sphr00620  Pyruvate metabolism
sphr00630  Glyoxylate and dicarboxylate metabolism
sphr00640  Propanoate metabolism
sphr00650  Butanoate metabolism
sphr00900  Terpenoid backbone biosynthesis
sphr01100  Metabolic pathways
sphr01110  Biosynthesis of secondary metabolites
sphr01120  Microbial metabolism in diverse environments
sphr01130  Biosynthesis of antibiotics
sphr01200  Carbon metabolism
sphr01212  Fatty acid metabolism
sphr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY17_3844
   00630 Glyoxylate and dicarboxylate metabolism
    BSY17_3844
   00640 Propanoate metabolism
    BSY17_3844
   00650 Butanoate metabolism
    BSY17_3844
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY17_3844
   00072 Synthesis and degradation of ketone bodies
    BSY17_3844
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY17_3844
   00310 Lysine degradation
    BSY17_3844
   00380 Tryptophan metabolism
    BSY17_3844
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY17_3844
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY17_3844
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY17_3844
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphr04147]
    BSY17_3844
Enzymes [BR:sphr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY17_3844
Exosome [BR:sphr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY17_3844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C TFIID_30kDa
Motif
Other DBs
NCBI-ProteinID: AOF95137
UniProt: A0A1B3MPV5
Position
pBSY17_1:773495..774751
Genome map
AA seq 418 aa AA seqDB search
MAEAFIIDAVRTPRSFGKLGKGALSHLHPQHVAATVLRAIRDRNGIDTADVDDVIWGTSA
QMGLQGGDMGRMAALDAGYDVRASGVTLDRFCGSGLTATNLAAAQIMAGMEDLVVAGGTE
MMSHVMSYGQSLREAGVPSVGGLGTGNLRLQAKHPQSNQGVAADAIAAMEGITREQLDAF
GAESQRRAGIAIKEGRFARSTVPVVDDDGAVILDHEEYPRPDTTAEQLAQLKPAFAAFLD
MPSRADGPTFRQLINQTYPDLAITPLHHAGTSSGVVDGAAALLLASADYAQRHGLTPRAR
VVATANMGDCPTLMLNGPVPAARKVLAKAGLRVEDIDVFEVNEAFAVVTEKFIRDLGIDR
AKLNPNGGAIALGHPIGATGAVLIGTALDELERTGGRYGLITMCAAGGMAPAIIIERV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttggcagaggcctttatcatcgacgccgtccgcacgccgcgcagcttcggcaagctgggc
aagggtgccctgtcccatctgcatccccagcatgtcgcggccacggtgctgcgtgcgatc
cgcgatcgcaatggcatcgacacggccgatgtcgacgacgtgatctggggcaccagcgcg
cagatgggattgcagggcggcgacatggggcggatggcggcgctggacgcgggctatgat
gtgcgcgcgtcgggcgtgacgctcgaccgcttctgcggcagtggcctgaccgccaccaat
ttggccgccgcgcagatcatggccgggatggaagatctggtcgtggcgggcgggaccgag
atgatgtcgcacgtcatgtcctatggccagtcattgcgtgaagcaggggtgccgtcggtc
ggcggccttggcaccggcaatctgcgcctgcaggccaagcatccccagtcgaaccagggc
gtcgccgccgatgccattgcggcgatggagggcattacgcgcgagcagctcgatgccttt
ggcgcggagagccagcggcgggcggggatcgcgatcaaggaagggcgatttgcccgatcg
accgtgccggtggtggatgatgatggcgcggtgatattggaccatgaggaatatccccgg
cctgataccacggccgaacagctggcgcagttgaagcccgcctttgcggcctttctcgac
atgccctcgcgcgccgatggcccgacattccgccagttgatcaaccagacatatcctgac
ctggcgatcacgccactgcaccatgcgggcacatcgtccggcgtggtcgatggcgcggcc
gccctattgctggcgtcggccgactatgcgcagcgccatggcctgacgccgcgcgcgcgg
gtcgttgcgaccgccaatatgggggattgcccgacattgatgttgaacggcccggtcccg
gccgcgcgcaaggtgctggcgaaagcagggttgcgggtcgaggatatcgacgtcttcgag
gtcaacgaagcctttgcggtcgtgaccgaaaagttcatccgcgatttggggatcgaccgc
gcgaagctcaatcccaatggcggcgcgattgcgcttggccatccgatcggggcgaccggc
gcggtgctgatcggcacggcattggacgagttggaacggacgggcggtcgctatggcctg
atcaccatgtgcgcggcgggcggcatggctccagcgatcatcatcgaacgtgtctga

DBGET integrated database retrieval system