KEGG   Sphingobium sp. RAC03: BSY17_3924Help
Entry
BSY17_3924        CDS       T04461                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K05296  3(or 17)beta-hydroxysteroid dehydrogenase [EC:1.1.1.51]
Organism
sphr  Sphingobium sp. RAC03
Pathway
sphr00984  Steroid degradation
sphr01100  Metabolic pathways
sphr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sphr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BSY17_3924
Enzymes [BR:sphr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     BSY17_3924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOF94638
UniProt: A0A1B3MNE9
Position
pBSY17_1:complement(867206..867964)
Genome map
AA seq 252 aa AA seqDB search
MGRVEGKVALVTGGGSGLGAADCVALAREGAMVVVTDVKLETAQRVADQIGGDAMALALD
VASEKDWIATMEAIEQRFGRLDILVNNAGVVLSADVEDTTLEQYRWVNAVMSEGVFLGCK
YAIPFMNRNDGGSIINMSSTGALLGYPIFFAYSAAKGAVRSMTKSIAVMCQEKGYKIRCN
SVHPGSIETPMVQQAEGRSGQEKTVPAGILKPGESGAPEDVAAMIVFLASDESRFVTGAE
MVVDNGVTIRPF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggtagaaggcaaggttgcgttggtcacaggcggcggttcgggccttggtgcc
gcggattgcgtcgcgctggcgcgagaaggagccatggtggtcgtaaccgacgtcaaactg
gaaaccgcccaacgcgttgcggaccaaatcggcggcgacgcaatggcactggcactcgac
gtagcgtcggaaaaagactggattgccaccatggaggccatcgaacagcggttcgggcgg
ctcgacatattggttaacaatgctggcgtcgtgttgagcgctgatgtcgaagacaccacg
ctggaacaatatcgctgggtcaacgccgtgatgagcgaaggcgtctttctaggatgcaaa
tatgcgatcccgtttatgaaccggaacgatggcgggtccatcatcaacatgtcatccacg
ggcgcgttgctcggctatccgatcttcttcgcttattccgctgccaagggtgctgtgcgg
tcgatgaccaagtcgattgcggtgatgtgccaggaaaagggatataagatccgctgtaat
tcggtgcatcccggctcgatcgaaacgccgatggtgcaacaggcggaggggcggtccggt
caggaaaagaccgtccccgccggtatattgaaacccggcgaaagcggcgcacccgaagat
gtggcggcgatgattgtgttcttggcctcggatgaatcgcgcttcgtcactggcgcggag
atggtggtcgacaatggcgtgaccatccggccattctga

DBGET integrated database retrieval system