KEGG   Sphingosinicella sp. BN140058: ETR14_11350Help
Entry
ETR14_11350       CDS       T05826                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
sphs  Sphingosinicella sp. BN140058
Pathway
sphs00380  Tryptophan metabolism
sphs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ETR14_11350
Enzymes [BR:sphs01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     ETR14_11350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: QAY77026
UniProt: A0A4P6FL68
Position
2500613..2501416
Genome map
AA seq 267 aa AA seqDB search
MADDAPKPITYGSYLALDAVLGAQHPVSEQNDEMLFVIIHQTKELWLKQILREVALSRAL
IGADSLVQVHKSLSRVSRIQAVMTLSWDVLATMTPSDYSSFRSVLGGSSGFQSYQFREFE
YRLGLKDGGHLRFQEEGSDAHGALVAALEEPSLWDEANKALARAGFALPEEAVARDWREP
YVPSDGVEAAWAEIYRDTTRWWPFYQLAEKLVDIDDALATWRHKHVVTVERIIGAKRGTG
GTAGVAYLQTTIGKRAFPELWSLRTRI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgatgcacccaagccgatcacttacggctcctatctggcgctggatgccgtg
cttggcgctcagcatcccgtctcggagcagaatgacgaaatgctgttcgtcatcatccac
cagaccaaggagctctggctcaagcagatcctgcgcgaagtggcgctgtcgcgcgctttg
atcggcgccgattcgctggtccaggttcacaagagcctgtcgcgggtctcgcggatccag
gcggtgatgacgctcagctgggacgtgctcgcgacgatgacgccgtccgattattcaagc
ttccggagcgtcctcggcggcagttcgggctttcaatcctatcagttccgcgaattcgag
taccgcctcggtctcaaggatggcggccacttgcgcttccaggaagagggttccgacgcg
catggagccctggttgctgcgctcgaggagccgagcctctgggacgaagccaacaaggca
ctcgcccgtgccgggttcgcgttgcccgaggaagccgtcgcacgggattggcgggagccg
tatgttcccagcgacggtgtcgaggcggcctgggcggagatctatcgggacacgacccgc
tggtggcccttttatcagctcgccgaaaagctcgtcgacatcgacgatgctcttgccacc
tggcgacacaagcacgtcgtcacggtcgagcggatcatcggtgcgaagcgcggcaccggg
gggaccgcgggggtcgcctatctgcagacgaccatcgggaagcgcgccttccccgaatta
tggtcgttgcgcacgcggatctga

DBGET integrated database retrieval system