KEGG   Sphingosinicella sp. BN140058: ETR14_15180Help
Entry
ETR14_15180       CDS       T05826                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sphs  Sphingosinicella sp. BN140058
Pathway
sphs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sphs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ETR14_15180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sphs03011]
    ETR14_15180
Ribosome [BR:sphs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ETR14_15180
  Bacteria
    ETR14_15180
  Archaea
    ETR14_15180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QAY77706
UniProt: A0A4P6FMY7
Position
3383284..3383661
Genome map
AA seq 125 aa AA seqDB search
MGKQASPRKVADNEALAVGTTIRGSAQKLNLVAALIRGRKAEDALNILSFSPKAMAVEVR
KVLASAIANAENNHNLDVDALVVAEASVGKSISMKRFTPRARGRSSRIIKPFSRVRIVVR
EQQEA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcaggcatccccccgcaaggtcgcggacaacgaggcgctcgcggtcggcacg
accatccgcggctccgcgcagaagctgaacctggttgctgcgctgatccgcggccgcaag
gccgaagacgcgctcaacatcctgtccttctcgcccaaggcgatggcggtcgaggttcgc
aaggtgctcgcgtcggcgatcgccaatgccgagaacaaccacaatctcgacgtcgacgcc
ctcgtcgtcgccgaggcttcggtcggcaagagcatctcgatgaagcgcttcacgccgcgc
gcacgcggtcgttcgagccggatcatcaaaccgttcagccgcgtgcgcatcgtcgtccgc
gagcagcaggaagcgtaa

DBGET integrated database retrieval system