KEGG   Sphingobium sp. TKS: K426_09415Help
Entry
K426_09415        CDS       T04965                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
spht  Sphingobium sp. TKS
Brite
KEGG Orthology (KO) [BR:spht00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    K426_09415 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AMK22828
UniProt: A0A126RKS7
Position
1:1864607..1865005
Genome map
AA seq 132 aa AA seqDB search
MNALFPFHATTRDINVHVAVTFLPEQSEPDRGRWFWAYHIRIENDGNQPVQLLTRHWIIT
DGRGTQHRVDGDGVVGEQPVVQPGRSYDYVSGCPLNTPTGSMKGHYHMIGASGETFDIAI
PHFALIAPAVAE
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcacttttccccttccacgcgaccacgcgcgacatcaacgtgcatgtggccgtc
accttcctgcccgaacagtcggagccggaccggggccgatggttctgggcctatcatatc
cgcatagaaaatgacgggaaccagccggttcaactgctgacccgtcactggatcattacc
gatgggcggggcacgcagcatcgggtcgatggagatggcgtcgtgggggaacagccagtg
gtgcagccgggcagaagctatgattatgtgtcgggctgcccgctcaacacgccgacgggt
tcgatgaagggccattatcacatgatcggcgcgagcggcgagacgttcgacatcgccatc
ccccatttcgcgctgatcgcgccggcggtggctgaatga

DBGET integrated database retrieval system