KEGG   Sphingobium sp. TKS: K426_12435Help
Entry
K426_12435        CDS       T04965                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
spht  Sphingobium sp. TKS
Pathway
spht00620  Pyruvate metabolism
spht00630  Glyoxylate and dicarboxylate metabolism
spht01100  Metabolic pathways
spht01110  Biosynthesis of secondary metabolites
spht01120  Microbial metabolism in diverse environments
spht01200  Carbon metabolism
Module
spht_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K426_12435
   00630 Glyoxylate and dicarboxylate metabolism
    K426_12435
Enzymes [BR:spht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     K426_12435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AMK23422
UniProt: A0A126RMV8
Position
1:2474063..2476156
Genome map
AA seq 697 aa AA seqDB search
MTSMTDRAGLQVAQQLASFIEERALPGTGIEAGAFWQGAAAIFAKFAPENAALLAKRDAI
QEQIDAWHGESGGRSFDGAAYQGFLREIGYLVPEPAPFQIGSENVDDEVARLAGPQLVVP
ILNARFLLNAANARWGSLYDALYGTDAIPGAAAGKGYDAQRGAQVIAWAKSFLDEAIPLA
SGSWADLTGGDIQLADPAQYRGKSEKGRLFRHNGLHIEVVFDRSHPIGKDDPAGIADVIL
ESALTTICDLEDSVAAVDAEDKVAAYSNWLGLMRGDLSDTFEKNGAMMTRALNPDRSYTA
PDGSSLTLPGRSLLFVRNVGHLMTTPAILLANGQETPEGILDGIVTTLIALHDLKRKGGN
SRTGSVYIVKPKMHGPEEVGFTNRLFDAIEDLLGLARHTLKVGVMDEERRTSANLAACIE
AVKDRIVFINTGFLDRTGDEMHTSMRAGPMIRKGEMKTSDWITAYEDRNVQIGLACGLSG
RAQIGKGMWAAPDRMADMLDQKVGHPKSGANTAWVPSPTAATLHATHYHRIDVFARQVER
KAEAIAPLDKLLTIPVAQGRNWSEEEIAQELDNNAQGILGYVVRWVDQGVGCSKVPDIHD
IGLMEDRATLRISSQHMANWLLHGVCTAEQVDAAFTRMAAKVDAQNAGDPLYRPMSGNPS
SLAWQAARALVFEGVGQPNGYTEPLLHKYRALAKAAA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatgaccgatcgcgcaggcctccaggtcgcgcagcaactcgccagcttcatc
gaggaacgggcgctccccggcacgggcatagaggccggagctttctggcagggcgccgcc
gcgatcttcgcgaagttcgccccggaaaatgccgcgctgctcgccaagcgcgatgcgatt
caggagcagatcgacgcctggcacggggaaagcggtgggcgcagcttcgatggcgcggcc
tatcagggctttctgcgcgagatcggttatctcgtccccgaaccggcgccgttccagatc
ggcagcgagaatgtcgatgacgaagtcgcccgcctcgccgggccgcaattggtcgttccg
atcctcaacgcccgtttcctgctgaacgccgccaatgcgcgctggggcagcctctatgac
gcgctctacggcaccgacgcgattcccggcgcggcggcgggcaagggctatgatgcgcag
cgcggcgcgcaggtcatcgcttgggccaaatccttcctcgacgaagccattccgctcgct
agcggctcttgggctgaccttaccggcggcgacatccagttggccgacccggcccaatat
cgcggcaaaagcgaaaagggccgcctgttccgccataacggcctgcacatcgaagtcgtc
ttcgaccgctcgcatccgatcggcaaggacgaccctgctggcatagccgacgtcatcctc
gaatccgcccttaccaccatctgcgacctggaagactcggtcgccgcggtggatgcggag
gataaggtcgccgcctattccaactggctcggcctgatgcggggcgacctcagcgacacg
ttcgaaaagaatggcgcgatgatgacccgcgcgctcaacccggatcgcagctacaccgcg
cccgacggcagcagcttaaccctgccgggccgcagcctgctgttcgtccgcaatgtcggc
catctgatgaccaccccggcaatcctgctcgccaacggccaggaaaccccggaaggcatt
ctcgacggcatcgtcaccacgctgatcgccttgcacgacctcaagaggaaaggtggcaac
agccgcactggcagcgtctatatcgtcaaacccaagatgcacggccctgaagaagtcggt
ttcaccaatcgcctgttcgacgccattgaggatctgctcggccttgcccgccacacgctg
aaggttggcgtcatggatgaggaacgccgcacctctgccaacctcgccgcctgcatcgag
gcagtgaaggaccgcatcgtcttcatcaacaccggcttcctcgaccgcaccggcgacgag
atgcacacgtcgatgcgcgccggcccgatgatccggaagggggagatgaagacgtccgac
tggatcacggcctatgaagaccgcaacgtccagatcggcctcgcctgtgggctttccggc
cgcgcccagatcggcaagggcatgtgggccgcgccggaccgcatggccgatatgctcgac
cagaaagtcgggcatccgaagagcggcgccaacaccgcctgggttccgtcccccaccgca
gcgacgctgcacgcgactcactatcatcgcatcgacgtcttcgcccgccaggttgagcgc
aaggctgaagccatcgcaccgctggataagctgctgaccatcccggtcgcgcagggccgc
aactggtccgaagaggaaatcgctcaggaactggacaacaacgcccagggcatccttggc
tatgtcgtccgctgggtcgatcagggcgtcggctgctccaaggttcccgacattcatgat
atcggcctgatggaagaccgcgccacgctgcgcatttcctctcagcatatggcgaactgg
ctgctccacggcgtctgcacggcggaacaggtcgacgccgccttcacccgcatggcggcc
aaggtcgatgcccagaatgccggcgatccgctctaccggcccatgagcggcaatccgtcc
agcctggcctggcaggccgctcgcgctctggtgttcgaaggcgtcggccagcccaatggc
tatacggaaccgctgctccacaaatatcgcgcgctggcgaaggcggcggcgtaa

DBGET integrated database retrieval system