KEGG   Sphingobium sp. TKS: K426_20715Help
Entry
K426_20715        CDS       T04965                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
spht  Sphingobium sp. TKS
Pathway
spht00780  Biotin metabolism
spht01100  Metabolic pathways
Module
spht_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:spht00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    K426_20715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spht01007]
    K426_20715
Enzymes [BR:spht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     K426_20715
Amino acid related enzymes [BR:spht01007]
 Aminotransferase (transaminase)
  Class II
   K426_20715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AMK25072
UniProt: A0A126RSK6
Position
1:4176478..4177602
Genome map
AA seq 374 aa AA seqDB search
MTSEPFRSQLAALEKRGRLRRLMPRAGRDFASNDYLGLASDPIIAQAVADAVARGVPVGS
GGSRLLRGNAPEHEGLEAKAADFFKTQGALFMANGFAANLALFSTLPQRGDLIVADELIH
ASVHDGIRMSKAVAVFARHNDVQSFADLIAAWRQEGGKGRVWIAVETLYSMDGDMAPLSD
LAVLAAKHEAMLILDEAHGTGVFGPSGRGLSAGLDGLHNVVTLHTCGKAMGVEGALICGP
RLLIDYLINRARAFIFSTAPSPLMAVAVSAALDRIEQASDLRDRLKTLRVDAGEAICAPL
GLPAPRSQIIPVILGEDRRAMAAAAALQQAGFDVRGIRPPTVPPGTSRLRISLTLNVGRA
DIAALGEALRKVVT
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgaacctttccgttcccaactggcggcgttagaaaagcggggccgcctgcgc
cgcctgatgccgcgcgccgggcgggactttgcctccaatgattatctcggcctcgcctcc
gacccgatcatcgcgcaggccgtggccgacgccgtggcgcggggcgtgccggtgggttcg
ggcggatcgcggctgctgcgcggcaatgcgcccgaacatgaagggctggaggccaaggcc
gccgatttcttcaagacgcaaggcgcgctgttcatggcaaacggcttcgccgccaatctg
gcgctgttttccaccctgccgcagcggggcgacctgatcgtcgcggacgagctgatccat
gccagcgtccatgacggcatccgcatgtcaaaggctgtggccgtcttcgcccgccataat
gatgtgcagagctttgccgacctgatcgccgcctggcggcaggaaggcggcaagggccgc
gtctggatcgccgtggaaacgctctattccatggatggggacatggcgccgctcagcgat
ctggcggtgctggcggcaaagcatgaggccatgctgatcctggacgaagcgcatggcacc
ggcgttttcgggccgtcggggcggggtctgtcggcgggtctggacgggctgcacaatgtc
gtgaccttgcacacctgtggcaaggcgatgggggtggagggcgcgctgatctgcgggccg
cgcctgctgatcgactatctgatcaaccgggcgcgcgccttcatcttctccaccgcgccc
tcgccattgatggcggttgcggtttcggccgcgctcgaccggatcgagcaggcgagcgac
ctgcgcgaccgtttgaagacgctgcgggtcgacgccggcgaagcgatttgcgcgccgctc
ggcctgcccgcgccgcgcagccagatcatcccggtcattttgggcgaggatcgccgggcc
atggccgccgccgccgccttgcagcaggctgggttcgacgtgcgcggcatccgcccgccg
accgtgccgccggggaccagccgcctgcggatttcgctcaccctgaatgtcggccgcgcc
gacattgctgcgctgggcgaggcgttgcgcaaggtagtgacatga

DBGET integrated database retrieval system