KEGG   Sphingobium sp. TKS: K426_25354Help
Entry
K426_25354        CDS       T04965                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spht  Sphingobium sp. TKS
Pathway
spht00010  Glycolysis / Gluconeogenesis
spht00020  Citrate cycle (TCA cycle)
spht00620  Pyruvate metabolism
spht01100  Metabolic pathways
spht01110  Biosynthesis of secondary metabolites
spht01120  Microbial metabolism in diverse environments
spht01130  Biosynthesis of antibiotics
spht01200  Carbon metabolism
Module
spht_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    K426_25354
   00020 Citrate cycle (TCA cycle)
    K426_25354
   00620 Pyruvate metabolism
    K426_25354
Enzymes [BR:spht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     K426_25354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AMK25974
UniProt: A0A126RV28
Position
2:complement(980525..981820)
Genome map
AA seq 431 aa AA seqDB search
MPIELKMPALSPTMEKGTLARWLVAEGDMVKPGDPVAEVETDKATMEIEAADGGRIASLV
IAEGTDDVAVGTVIALIAESGDAVPEPVLEQAVPVPAAAGPVEATPVASMPAQAPVQPRH
APEVAAPRARLSPAERVKVSPLALRIAGAKGINLDGISGTGPNGRIVRADLGIGSLVTSR
PDAVPQAIAVQPAPAIASPPAGVPAQSVKLSSMRKTIARRLTEAKQTVPHFYLTARCNLD
PLLKLRGELNAGLASRGVKLSVNDMLIKAMALALVEVPDANVQFGGDELHRFGRVDISMA
VAIDGGLVTPVIQGADTLSLSAIATASKMLAIKARDGKLLPEEYQGGTASISNLGMFGID
EIFPVINPPQALILGVGAGVEQPWKVDGKIGLATIVAATASFDHRAIDGAVAARFIQALR
ALVEEPVRILA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgaactcaagatgccggcgctgtcgccgacgatggaaaaaggcacgctcgca
agatggctggtggccgaaggcgacatggtgaagcccggcgatcctgtcgccgaagtcgaa
accgacaaggcgacgatggagattgaggcagccgatggaggtcgcatcgcaagtctcgtc
atcgccgaaggcacagacgacgtcgcggtcgggacggtcatagccttgatcgccgaatcc
ggcgacgccgttccggagcccgtgctcgagcaggcggttccggttcctgccgctgccggg
cccgtcgaggccaccccagtggcgtccatgcccgctcaagcccctgtccagcccaggcat
gcgccggaagtggccgcgccccgtgcccgcctgtcgcctgccgaacgggtcaaggtcagc
ccgcttgcccttcgcatcgccggggccaagggaatcaaccttgacggcattagcgggacg
ggccccaatggccgcattgttcgagcggaccttggcatcgggtcactcgttacgtcacga
cccgacgccgttccccaggcgatcgccgttcaaccggcgcccgcgatcgcgagcccccct
gcaggcgtcccggcgcaatcggtcaagctcagctcgatgcgcaagacgatcgcgcggcgg
ctcaccgaagccaagcagaccgttccgcatttttacctgacggcgcgttgcaatctcgat
ccgctgctgaaactgcggggtgaactgaacgccggcctcgcctcacgcggcgtcaagctc
agcgtcaacgacatgctgataaaggccatggcgctcgcgctcgtcgaggtgccggatgcg
aacgtgcagttcggcggcgacgaactgcatcgcttcggtcgcgtcgacatttcgatggct
gtggcgatcgatggcggtctcgtcacgccggtgatccaaggtgcggacacgctctcgctt
tccgccatcgcaacggccagcaagatgctcgccatcaaggcgcgcgacgggaagttgctg
cccgaggaatatcagggcggcaccgcgtccatctccaatctcggcatgttcgggatcgat
gagatatttcccgtcatcaacccgccacaggcgttaattctcggcgttggcgcgggcgtc
gagcagccatggaaggtcgatgggaagatcggccttgcaaccatagtcgccgcgactgcc
agcttcgatcatcgcgccatcgatggcgcggtcgcggctcggttcatacaggcactacgc
gccctggtggaagagccggtgcgcatcttggcctga

DBGET integrated database retrieval system