KEGG   Sphingobium sp. TKS: K426_28095Help
Entry
K426_28095        CDS       T04965                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spht  Sphingobium sp. TKS
Pathway
spht00071  Fatty acid degradation
spht00072  Synthesis and degradation of ketone bodies
spht00280  Valine, leucine and isoleucine degradation
spht00310  Lysine degradation
spht00362  Benzoate degradation
spht00380  Tryptophan metabolism
spht00620  Pyruvate metabolism
spht00630  Glyoxylate and dicarboxylate metabolism
spht00640  Propanoate metabolism
spht00650  Butanoate metabolism
spht00900  Terpenoid backbone biosynthesis
spht01100  Metabolic pathways
spht01110  Biosynthesis of secondary metabolites
spht01120  Microbial metabolism in diverse environments
spht01130  Biosynthesis of antibiotics
spht01200  Carbon metabolism
spht01212  Fatty acid metabolism
spht02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K426_28095
   00630 Glyoxylate and dicarboxylate metabolism
    K426_28095
   00640 Propanoate metabolism
    K426_28095
   00650 Butanoate metabolism
    K426_28095
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K426_28095
   00072 Synthesis and degradation of ketone bodies
    K426_28095
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K426_28095
   00310 Lysine degradation
    K426_28095
   00380 Tryptophan metabolism
    K426_28095
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K426_28095
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K426_28095
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K426_28095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spht04147]
    K426_28095
Enzymes [BR:spht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K426_28095
Exosome [BR:spht04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K426_28095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMK26518
UniProt: A0A126RWD9
Position
pTK2:complement(79576..80760)
Genome map
AA seq 394 aa AA seqDB search
MSHDPVVIASYARTPMGGFQGAFANVKATDLGAAAVEAARARAAVAPDLIERIYMGCVLP
AGLGQAPARQAALSAGLPQSVEATTVNKMCGSGMQAAIMAYDALAAGSVDVAIAGGMESM
TNAPYALPKHRGGARIGHDRIIDTMMMDGLEDAYEPGKAMGVFAEDAARDYQFTRAQQDD
FAIRSLGRANAAIASGAFAREIAPVTVGNRGGDVVVDTDEQPGKAKPERIPTLKPAFIKD
GTITAANASSISDGAAALVMTRQSVAQKLGLPVVARVIATAAHAHEPAKFTTAPVPAIRK
LLAKAGWDVSDVDLFEINEAFALVPMIAARDLGISEDRLNVNGGATALGHPIGASGARIL
ATLLGALELRGLKRGVASLCIGGGEATAMAVELV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatgatcccgtcgtcatcgccagctacgcccgcacgccgatgggcggctttcag
ggcgcttttgccaacgtgaaggcaaccgatctgggcgccgccgcggtcgaggcggccagg
gcgcgcgccgccgtcgcgcccgaccttatcgagcgcatttatatgggctgcgtgctgccc
gccgggctcggccaggcgcccgcgcgccaagcggcgctgagcgccggccttccacagtcg
gtcgaggccaccacggtcaacaagatgtgcgggtcgggcatgcaggcggcgatcatggcc
tatgatgcgctggcggccgggtcggtcgatgtcgcgatagcgggcggcatggaaagcatg
accaacgcgccctatgccctgcccaagcatcgcggcggcgcccgcatcggccatgaccgg
atcatcgacacgatgatgatggacgggctggaggacgcctatgagccaggcaaggcgatg
ggcgtcttcgccgaggacgcggcgcgcgactatcagttcacgcgcgcgcagcaggatgat
ttcgcgatccgatcgctcggccgcgccaatgccgcgatcgccagcggcgctttcgcgcgc
gagatcgcgcccgtgacggtcggcaaccggggcggcgacgtggtcgtcgacactgacgag
cagcccggcaaggcgaagccggaaaggatcccgacgctcaagcccgccttcatcaaggac
ggcacgatcaccgccgccaacgcgtcgtccatttctgatggcgccgcggcgctggttatg
acccggcagagcgtcgcgcagaagctcggcctaccggtcgtggcacgggtgatcgccacg
gccgcccatgcccatgagcccgccaaattcacgactgcgccggttcccgcgatccgcaaa
ctgctggccaaagcgggctgggacgtgtccgatgtcgatctgttcgagatcaacgaagcc
ttcgccctcgtgccgatgatcgccgcgcgcgatttgggtatttccgaagacaggctgaac
gtcaatggcggggcgaccgcacttggccatccgatcggtgcgtcgggcgcgcgcatcctg
gcgactttgctgggcgcgctggaacttcgcgggctcaagcgcggtgtcgccagtctgtgc
atcggcgggggcgaagccaccgccatggccgtcgaactcgtctga

DBGET integrated database retrieval system