KEGG   Uncultured Sphingopyxis sp. UC10: SPPYR_1138Help
Entry
SPPYR_1138        CDS       T05531                                 

Gene name
gatA
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sphu  Uncultured Sphingopyxis sp. UC10
Pathway
sphu00970  Aminoacyl-tRNA biosynthesis
sphu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPPYR_1138 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sphu03029]
    SPPYR_1138 (gatA)
Enzymes [BR:sphu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPPYR_1138 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPPYR_1138 (gatA)
Mitochondrial biogenesis [BR:sphu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPPYR_1138 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: SBV32258
UniProt: A0A1Y5PQF5
Position
SPPYR:1241064..1242545
Genome map
AA seq 493 aa AA seqDB search
MTDLTNLTVAQIRDGHRAGDFSAVEVAEAFNANVAGAKALNAFIVETPEHAIAAAKAADA
DRAAGTLKPLSGVPIGMKDLFATNGVQTTAASHMLEGFVPRYESTVSAKLWDAGCGMLGK
LNLDQFAMGSSNETSYFGNVISPWRRKDGGNAALAPGGSSGGSSSAIAARLCPAATGTDT
GGSIRQPAAFTGISGIKPTYGRCSRWGIVAFASSLDQAGPMARDVKDCAIMLENMAGFDP
KDATSLDLPVPNWEAALSSDLKGKTVGIPKEYRLEGIDPDIDAMWDAGIAMLKDAGADVV
EISLPHTKYALPAYYIIAPAEASSNLARYDGVRYGLRDLPQGAGLQDMYAATRADGFGPE
VKRRIMIGTYVLSAGFYDAYYTQAQKVRTLIARDFEQAFGVCDVILAPTAPSAAFGLGEK
MADPLAMYLNDVFAVPASLAGLPAMSVPAALNREGLPLGLQIIGKAFDEQGVLNAGLAIE
ERAGFTARAEKWW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcttacaaatctaacggtcgcgcagatccgcgacgggcaccgcgcgggcgat
ttcagcgccgtcgaggtcgccgaggcgttcaacgccaatgtcgcgggcgcgaaggcgctc
aatgcgttcatcgtcgagacgcccgagcatgcgatcgcggcggcgaaggcggccgatgcc
gaccgcgcggcggggacgctcaagcccttgtcgggcgtgccgatcgggatgaaggatttg
ttcgcgacgaacggcgtccagaccaccgccgcgagccatatgctcgaaggctttgtcccg
cgctatgaatcgaccgtttcggcgaaactgtgggacgcgggttgcgggatgctcggcaag
ctcaacctcgaccagttcgcgatggggtcgtcgaacgagacgagctatttcggcaatgtg
atttcgccatggcggcgcaaagatggcggcaatgccgcgctcgcgccgggcggctcgtcg
ggcggctcgtcgtcggcgatcgcggcgcggctctgccccgcggcgacggggaccgacacc
ggcggctcgatccgccagcccgcggccttcaccggcatttcggggatcaagccgacctat
ggccgctgctcgcgctggggcatcgtggcgttcgcgagctcgctcgatcaggcggggccg
atggcgcgcgacgtcaaggactgcgcgatcatgctcgaaaatatggcgggcttcgatccg
aaggatgcgaccagcctcgacctgccggtgccgaattgggaagcggctttgtcgagcgat
ctcaagggcaagacggtcggtattcccaaggaatatcggctggagggcatcgatcccgac
atcgacgcgatgtgggatgcggggatcgcgatgctgaaggatgcgggggccgatgtcgtc
gagatcagcctgccgcacaccaaatatgcgctgccggcttattatatcatcgcgcccgcc
gaggcgtcgtcgaacctcgcgcgctatgacggcgtgcgttacggtttgcgcgacctgccg
cagggcgcggggctgcaggacatgtatgcggcaacgcgcgccgacggcttcgggcccgag
gtcaagcgccgcatcatgatcggtacctatgtgctgtcggcgggtttctacgatgcctat
tacacgcaggcgcagaaggtgcggacgctgatcgcgcgcgacttcgagcaggcgttcggg
gtgtgcgacgtgatcctcgcgccgacggcgccgtcggcggcgttcgggctcggcgagaag
atggccgatccgctggcgatgtatctgaacgatgtgttcgcggtgcccgccagcctcgcg
gggctgcccgcgatgtcggtgcccgccgcgctgaaccgcgaagggctgccgctgggcttg
cagatcatcggcaaggcgttcgacgagcagggcgtgctgaacgccgggctggcgatcgag
gagcgcgcgggctttacggcgcgggcggagaagtggtggtag

DBGET integrated database retrieval system