KEGG   Uncultured Sphingopyxis sp. UC10: SPPYR_1439Help
Entry
SPPYR_1439        CDS       T05531                                 

Gene name
mhpE
Definition
(GenBank) 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase, class I
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
sphu  Uncultured Sphingopyxis sp. UC10
Pathway
sphu00360  Phenylalanine metabolism
sphu00362  Benzoate degradation
sphu00621  Dioxin degradation
sphu00622  Xylene degradation
sphu01100  Metabolic pathways
sphu01120  Microbial metabolism in diverse environments
sphu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sphu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SPPYR_1439 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPPYR_1439 (mhpE)
   00622 Xylene degradation
    SPPYR_1439 (mhpE)
   00621 Dioxin degradation
    SPPYR_1439 (mhpE)
Enzymes [BR:sphu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     SPPYR_1439 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm PALP HATPase_c
Motif
Other DBs
NCBI-ProteinID: SBV32559
UniProt: A0A1Y5PRE0
Position
SPPYR:1549118..1550149
Genome map
AA seq 343 aa AA seqDB search
MNAVTSKLYIQDVTLRDGMHAIRHRYSLDQVQAIAKALDTAKVDAIEIAHGDGLGGSSLN
YGFGAHTDWDWIAAVADVLDHSILTTLLLPGIGTVEDLKHAFDLGVGSVRVATHCTEADV
SKQHIEAARKLGMDVSGFLMMSHMSPPDKLAEQAKLMEAYGAHCVYVTDSGGALTTDMVA
ERFAAYDRALKPETQRGIHAHHNLSLGVANSVVAVQNGAIRVDASLAGMGAGAGNAPLEV
FIAVADIYGWSHGTDLFTLMDAADELVRPLQDRPVRVDRETLSLGYAGVYSSFLRHAETA
AVAHDLDVREILIELGRRRMVGGQEDMIFDVALDLVQQRERSA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgtaacctccaagctctatattcaggacgtcaccctccgcgatggcatgcac
gccattcggcaccgttacagcctcgatcaagtccaggcgattgcgaaagcgctggacacg
gcgaaggtcgacgcgatcgagattgcacatggcgatgggcttggaggatcgtcgctgaat
tacggcttcggtgctcacacggactgggactggatcgcggcggtcgccgatgtcctcgac
catagtattttgacgacattgctcctcccgggcattggtacggtcgaggacctcaaacac
gccttcgaccttggcgtaggttcggttcgcgtcgccacgcattgcaccgaagccgatgtc
tccaaacagcatatcgaggctgcgcgcaaactcgggatggatgtgtcgggctttttgatg
atgagccacatgtcgccgccggacaagctggccgagcaagccaagctaatggaagcctat
ggtgcgcactgcgtctatgtgaccgacagcggtggtgcgctgaccactgacatggtggcc
gaacgcttcgccgcgtacgaccgggcgctgaaaccggaaacccagcgcggcatccacgcc
catcacaacctcagcctgggcgtcgccaattcggtggtcgcggtgcagaatggtgcgatc
cgtgtggatgcatcgcttgccggcatgggggcgggagcgggcaatgcgccgctcgaagtc
ttcatagccgtcgcagacatatatggatggtcgcatggcaccgatctttttacattgatg
gatgccgccgacgaattggtccggccgcttcaggatcgacccgtacgcgtcgatcgcgaa
accttgagtctcggctatgcgggggtttattcgagcttcctgcgccacgccgagacggct
gccgtggcccatgacctcgacgtcagggaaattctgattgaactgggacgccggcgcatg
gtcggcggccaggaggatatgatattcgacgtggcgctcgacctggtccagcaacgcgag
cgatcggcctga

DBGET integrated database retrieval system