KEGG   Uncultured Sphingopyxis sp. UC10: SPPYR_3582Help
Entry
SPPYR_3582        CDS       T05531                                 

Gene name
phaA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphu  Uncultured Sphingopyxis sp. UC10
Pathway
sphu00071  Fatty acid degradation
sphu00072  Synthesis and degradation of ketone bodies
sphu00280  Valine, leucine and isoleucine degradation
sphu00310  Lysine degradation
sphu00362  Benzoate degradation
sphu00380  Tryptophan metabolism
sphu00620  Pyruvate metabolism
sphu00630  Glyoxylate and dicarboxylate metabolism
sphu00640  Propanoate metabolism
sphu00650  Butanoate metabolism
sphu00900  Terpenoid backbone biosynthesis
sphu01100  Metabolic pathways
sphu01110  Biosynthesis of secondary metabolites
sphu01120  Microbial metabolism in diverse environments
sphu01130  Biosynthesis of antibiotics
sphu01200  Carbon metabolism
sphu01212  Fatty acid metabolism
sphu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPPYR_3582 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    SPPYR_3582 (phaA)
   00640 Propanoate metabolism
    SPPYR_3582 (phaA)
   00650 Butanoate metabolism
    SPPYR_3582 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPPYR_3582 (phaA)
   00072 Synthesis and degradation of ketone bodies
    SPPYR_3582 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPPYR_3582 (phaA)
   00310 Lysine degradation
    SPPYR_3582 (phaA)
   00380 Tryptophan metabolism
    SPPYR_3582 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPPYR_3582 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPPYR_3582 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPPYR_3582 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sphu04147]
    SPPYR_3582 (phaA)
Enzymes [BR:sphu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPPYR_3582 (phaA)
Exosome [BR:sphu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPPYR_3582 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: SBV34697
UniProt: A0A1Y5Q4K0
Position
SPPYR:complement(3759453..3760682)
Genome map
AA seq 409 aa AA seqDB search
MEIDHMTLRRAAIVAPIRTAVGKFGGALSSMTAGELGAVILKALVERTQIDPARVDDVVF
SQGYGNGEAPSIGHWSWLAAGLPIEVPGYQLDRRCGSGLQAVINAAMMVQTGMSDVVVAG
GVESMSNVEHYSTDIRKGVRAGNLTLHDRLTRGRVMSQPVERFGVITGMIETAENLAKDY
GISREAADAYAVRSHQRAAAAWAKGLFDDELVPVAVPQKKGDPVVFAHDEGYRADASMET
LGKLRPLEGGVVTAGNASQQNDAAAACLVVAEDKLDELGLEPIAWYHSSAAAGCDPSRMG
IGPVPAVERLFARSGLGWGDIDLVELNEAFAPQVLAVLKGWGWSDDDSRNAILNANGSGI
SLGHPIGATGGRILANLTRELVRRDGRYGLETMCIGGGQGIAAIFERAA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggagattgaccatatgaccctgcgccgcgccgccatcgtcgccccgatccgcaccgcc
gtcggcaagttcgggggcgcgctttcgtcgatgaccgcgggcgaactcggcgcggtgatc
ctgaaggcgctggtcgagcggacgcagatcgatccggcgcgcgtcgacgacgtcgtcttt
tcccagggctatggcaatggcgaggcgccgagcatcggccactggtcgtggctcgccgcg
gggctgccgatcgaggtgccgggctatcagctcgaccgccgctgcggttcgggcttgcag
gcggtgatcaacgccgcgatgatggtgcagacgggcatgtccgacgtcgtcgtcgcgggc
ggcgtcgaatcgatgtcgaacgtcgaacattacagcacggacattcgcaagggcgtgcgc
gcgggcaacctcacgctccacgaccggctgacgcgcgggcgggtgatgtcgcagccggtc
gagcgtttcggggtgatcaccggcatgatcgagaccgccgaaaatctcgccaaggattat
ggcatctcgcgcgaagcggccgatgcctatgcggtgcggagccatcagcgcgcggcggcg
gcgtgggcgaaggggctgttcgacgacgagctggtgccggtcgcggtgccgcagaagaag
ggcgatccggtcgtcttcgcgcacgacgagggctatcgcgccgatgcgagcatggagacg
ctcggcaagctgcgtccgctcgaaggcggggtggtgacggcgggcaatgcgagccagcag
aatgatgcggcggcggcgtgcctcgtcgtcgccgaggacaagctcgatgaactcggattg
gaaccgatcgcctggtatcacagctcggcggcggcgggctgcgacccgagccggatgggc
atcgggccggtgcccgcggtcgagcggctgttcgcgcgcagcggcctcggctggggcgac
atcgatctggtcgagctcaacgaagccttcgcgccgcaggtgctcgcggtcttgaagggc
tggggctggtcggacgacgacagccggaacgcgattttgaatgccaacggctcgggcatc
tcgctcggccacccgatcggcgcgaccggcgggcgcatcctcgccaatctgacgcgcgaa
ctggtgcgccgcgacggacggtacgggctcgagacgatgtgcatcggcggcgggcagggc
atcgccgcgatcttcgagcgcgctgcatag

DBGET integrated database retrieval system