KEGG   Sphingorhabdus sp. YGSMI21: CHN51_07055
Entry
CHN51_07055       CDS       T05308                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
sphy  Sphingorhabdus sp. YGSMI21
Pathway
sphy00626  Naphthalene degradation
sphy01100  Metabolic pathways
sphy01120  Microbial metabolism in diverse environments
sphy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sphy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CHN51_07055
Enzymes [BR:sphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CHN51_07055
SSDB
Motif
Pfam: DHDPS CutC
Other DBs
NCBI-ProteinID: ATW03328
UniProt: A0A2D3RC67
Position
1442948..1443934
AA seq 328 aa
MTRTLMKSGDVKGAWAIIPTPAKDKASDWRATNTVDLDETARVVNGLIDAGINGILSMGT
LGEAATMTHDEKLDFMKALVDAAAGRVPIFVGTTCINTRDTVALTRQALELGADGTMLGI
PMWCAPSLDVAVQFYKDVAEAVPEMNIAIYANPEAFKFDFPRPFWAQVAEIPQVVTAKYI
GIGNLLADLSAIRGRIKLLPIDFDYYAAARMDDSIDAFWSSGSVCDPLVTTTIRDNILKA
RETGDWNAARAFQARLGPTAAPLFPNGSFKEFSTYNIALEKARMNAGGWMNAGPVRPPYH
LCPEPYLEGARLSGRMWAELGKALAAEK
NT seq 987 nt   +upstreamnt  +downstreamnt
atgacacgtacacttatgaaatctggtgacgtcaaaggcgcttgggcgattattcccact
ccggcgaaggataaagcctcggattggcgagcgacaaatacggtcgatctcgatgaaact
gcgcgcgtggtgaacggcctgatagacgcggggatcaacgggattctcagtatggggacg
cttggcgaagcggcgaccatgacccacgacgaaaagctcgatttcatgaaggcgctggtc
gatgctgcggccggccgggtgccgatattcgtcggcaccacctgcatcaacacccgcgac
accgtagcattgacccggcaagcgcttgaactcggcgcggatggcacgatgctgggaatt
ccgatgtggtgcgcgcccagccttgacgttgctgtccagttctacaaggacgtcgctgaa
gccgtcccggagatgaacattgcaatctacgccaatccggaggctttcaagtttgatttt
ccgcggccgttctgggcacaagtagctgaaattccgcaggtcgttaccgccaaatatatc
ggtatcggcaacctgctggcggacctttcggctattcgcggtcggatcaagttgttgccg
atcgacttcgactattacgctgcggcccgcatggacgattcgatcgacgctttctggtcc
agcggctctgtgtgcgacccgttagtgaccacaacgattcgcgacaatattttgaaagcc
cgcgaaaccggtgactggaacgcggcacgcgccttccaggcgcgactcggaccgacggca
gctccgctgttcccgaacggcagcttcaaggaattctcgacctacaacatcgcgctagaa
aaggcgcgcatgaatgccggtgggtggatgaatgctggcccggttcggccaccataccat
ctttgtccggaaccgtacctcgagggcgcacgcctgtcgggcagaatgtgggccgaactt
ggcaaggcactcgcggccgaaaaatga

DBGET integrated database retrieval system