KEGG   Sphingorhabdus sp. YGSMI21: CHN51_11850Help
Entry
CHN51_11850       CDS       T05308                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
sphy  Sphingorhabdus sp. YGSMI21
Pathway
sphy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sphy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CHN51_11850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sphy01007]
    CHN51_11850
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sphy03016]
    CHN51_11850
   03029 Mitochondrial biogenesis [BR:sphy03029]
    CHN51_11850
Enzymes [BR:sphy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     CHN51_11850
Amino acid related enzymes [BR:sphy01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CHN51_11850
Transfer RNA biogenesis [BR:sphy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CHN51_11850
 Prokaryotic Type
   Other AARSs
    CHN51_11850
Mitochondrial biogenesis [BR:sphy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CHN51_11850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ATW04142
UniProt: A0A2D3REL7
Position
2445001..2446725
Genome map
AA seq 574 aa AA seqDB search
MMLFHIFQKHIDAILDKLTEAGVLPAGVDRSNVTLEPPRDPSHGDLSTNAAMVLSKAAGM
KPRDLAEKIAEKLGGLDDVQSVDIAGPGFINLRVAAPVLLGELLEIEQLGAEYGRSDKGK
GVTVNIEYVSANPTGPMHMGHCRGAVVGDALADLLEAVGNKVIREYYVNDAGSQVDTLAR
SAHLRYLEALGEDIGTIPEGLYPGDYLKPVGEALAAEFGDKYKDAAEADWLLTFRKAAVA
KMMDMIRSDLAMLGIRHDVFSSEAELHEAGKADAAEAELRSRDLVYDGELEQPKGKVIED
WEAVELPLFRSTQFGDDQDRPIKKSNGRWTYFGGDLAYHFQKAQSADELIDIWGADHSGT
VKRIKAAVAALTGGKTKFDVKLVQMVRLLRNGEPEKMSKRSGNFVTIADMVEEVGKDAVR
FTMLTRKADAQMDFDFAKVMEASRDNPVFYVQYAHARIQSMLRKAAEDGVTPSADHLDRL
GEEEMDLIKMAAQFPRIIESAAASREPHRVAFYLNDLAAAFHGYYNLGNDRPDKRIIMVN
DPETTSARLFLAKNIGQTVKNGLALMGVEAAESM
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atcatgctgttccacatttttcaaaagcatattgatgcgatattggataaactgaccgaa
gcgggcgtgcttccggccggggtcgaccggtcgaatgtcacgctggagccgccgcgcgat
ccgtcgcacggtgacctgtcgaccaacgcggcgatggtcctgtccaaggcggcgggcatg
aagccgcgcgatctggcggaaaaaattgcggaaaagctgggtgggcttgatgacgtgcag
tcagtcgatatcgccggtcccggatttatcaacctgcgggttgcagcgcccgtattgctc
ggcgaattgctcgaaatcgagcagctgggcgcagaatatggccgctccgacaagggcaag
ggtgtgaccgtcaatatcgaatatgtctcggccaacccgaccggaccgatgcacatgggc
cattgccgtggtgcggtggtcggcgacgcgctggctgatctgctcgaggcggtcggtaac
aaggtgatccgcgaatattatgtcaatgatgccggatcgcaggtcgacacgctcgcccgc
tcggcgcatctgcgttatctcgaggcgctgggcgaggatatcggcacgatacccgaaggc
ctctacccgggcgactatctgaaaccggttggcgaagccctggccgcagaatttggcgac
aaatacaaggatgcggcggaagccgactggctgctgaccttccgcaaggccgcggtcgcc
aagatgatggacatgatccgttccgatctggccatgctcggcatccgccacgatgttttc
tcctccgaggcagaattgcacgaagcgggcaaggcggacgccgccgaggccgagctgcgc
tcccgcgatctcgtctacgacggggagctggaacagcccaagggcaaggtgatcgaggac
tgggaagcggtcgagctgccgctgttccgttcaacgcaatttggcgatgaccaggaccgc
ccgatcaagaaatccaacggccgctggacctattttggcggcgatctcgcctatcatttc
cagaaagcgcaatcggccgacgaactgatcgatatctggggcgccgatcacagcggtacg
gtcaagcggatcaaggccgcggtcgcggcgctgaccggtggcaagaccaaattcgacgtg
aagctggtgcaaatggtgcgcctgctgcgcaacggcgagcctgagaaaatgtccaaacgc
tcgggcaattttgtcaccatcgccgacatggtcgaggaagtcggcaaggacgccgtgcgt
ttcaccatgctgacccgcaaggccgacgcgcagatggacttcgattttgccaaggtgatg
gaagcctctcgcgacaatccggtcttctatgtgcaatatgcccatgcccggatccagtcg
atgctgcgcaaggcggcggaagacggcgtaaccccttcggccgatcatctggatcgtcta
ggcgaggaggaaatggacctcatcaaaatggcggcgcaattcccccggatcatcgaatcg
gccgcggcatcgcgggagccccatcgagtcgcattctatctgaatgatctggcagcggct
tttcacggctattataatctcggcaatgaccggcctgacaagcggatcataatggttaac
gacccggaaacgacatcggcgaggcttttcttagccaagaatatagggcagactgtgaag
aacggtcttgcattgatgggtgtagaggccgcagaatcgatgtaa

DBGET integrated database retrieval system