KEGG   Sphingorhabdus sp. YGSMI21: CHN51_12285Help
Entry
CHN51_12285       CDS       T05308                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
sphy  Sphingorhabdus sp. YGSMI21
Pathway
sphy00270  Cysteine and methionine metabolism
sphy00480  Glutathione metabolism
sphy01100  Metabolic pathways
Module
sphy_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:sphy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CHN51_12285
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CHN51_12285
Enzymes [BR:sphy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     CHN51_12285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ATW04221
UniProt: A0A2D3REU6
Position
2541167..2542123
Genome map
AA seq 318 aa AA seqDB search
MTLKIAVQMDPMESVNIAGDSSFALMLCAQKRGHQIFHYDVKGLTLQANGRLTTPAHPVT
VRPVKGDHFTFGESVKLDLGSDVDVVLMRQDPPFHVGYITATHLLERIEGETLVVNNPVS
VRNAPEKVYVLDYAQFMPPTLITRDLDEVRAFQKEHGGVVVKPLHGNGGKAIFLVPEDGS
NLSALFEVFNQTWPEPHMVQPFLPEVHQGDKRIVLVDGEVAGAINRKPGEGEFRSNLAQG
GYAEAAELTDREKEICAAMGPDLKRLGLIFVGIDVIGGKWLTEINVTSPTGIVAIDNFNG
TDTAGMIWDAIERRIAEQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgaaaatcgccgtacagatggatccgatggaaagcgtaaacatcgcgggcgac
agcagcttcgcgctgatgctctgcgcccagaagcgcgggcatcagattttccattatgac
gtcaagggcctgaccctgcaggccaatggccgcctgaccacaccggctcatccggtgacc
gtgcggccagtgaagggcgaccatttcaccttcggcgagtccgtaaaactcgacctcggc
agcgatgtcgacgtcgtgctgatgcgtcaggacccgccgtttcacgtcggctatatcacc
gcgacgcatttgctcgagcggatcgagggcgagacactggtggtcaacaaccccgtctcc
gtccgcaacgcgccggagaaagtctatgtgcttgactatgcccagttcatgccgccgacc
ctgatcacccgcgacctcgacgaagtgcgcgccttccagaaggaacatggcggcgtggtg
gtcaagccgctgcacggcaatggtggcaaggcgatcttcctggtgccggaagacggcagc
aatctcagcgcattgttcgaggtgtttaaccagacctggccagaaccgcatatggtccag
cccttccttcccgaagtgcatcagggcgacaagcgcattgtgctggtcgacggcgaagtt
gccggtgcgatcaaccgcaagccgggcgaaggcgaattccgcagcaacctcgcgcagggc
ggctatgccgaagcggcggagctgaccgaccgcgagaaagaaatctgcgcggccatggga
ccggatctgaaacggctcgggctgatcttcgtcggcatcgatgtcatcggcggcaagtgg
ctgaccgagatcaacgtgacctcgccgaccggcattgtcgcaatcgacaatttcaacggc
accgatacggcgggcatgatctgggacgcaatcgagcggcgaattgccgaacaatag

DBGET integrated database retrieval system