KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0053Help
Entry
MGAS10750_Spy0053 CDS       T00356                                 

Gene name
rpsC
Definition
(GenBank) SSU ribosomal protein S3P
  KO
K02982  small subunit ribosomal protein S3
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MGAS10750_Spy0053 (rpsC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spi03011]
    MGAS10750_Spy0053 (rpsC)
Ribosome [BR:spi03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    MGAS10750_Spy0053 (rpsC)
  Archaea
    MGAS10750_Spy0053 (rpsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S3_C KH_2 KH_4 MRP-S24
Motif
Other DBs
NCBI-ProteinID: ABF37003
UniProt: Q1J908
Position
69316..69969
Genome map
AA seq 217 aa AA seqDB search
MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKELADASVSTIEIERAV
NKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIEIKQPDLDAHLVGENIA
RQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIARAEGYSEGTVPLHTLRAD
IDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcaaaaagtacatccaattggtatgcgtgtcggaatcatccgtgactgggatgcg
aaatggtatgctgaaaaagaatacgcggattaccttcatgaagatcttgcaatccgtaaa
ttcattaataaagaattagctgacgcatcagtttcaactattgaaattgaacgtgcagta
aacaaagttattgtttcacttcacactgctaaaccaggtatggttatcggtaaaggtggc
gcaaatgttgacgctcttcgtggtcaacttaacaaattaactggaaaacaagtacacatc
aacatcatcgaaatcaaacaacctgatttagatgctcaccttgttggtgaaaatattgct
cgtcaacttgagcaacgtgttgctttccgtcgtgctcaaaaacaagcaatccaacgtaca
atgcgtgcaggagctaaagggattaaaactcaagtttctggtcgtttgaacggtgctgat
atcgctcgtgctgaaggttattcagaaggaactgttccacttcacacgcttcgcgctgat
atcgactatgcttgggaagaagctgacacaacttatggtaaacttggcgttaaagtttgg
atttaccgtggagaagttcttccagctcgtaaaaacactaaaggaggcaaataa

DBGET integrated database retrieval system