KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0124Help
Entry
MGAS10750_Spy0124 CDS       T00356                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00071  Fatty acid degradation
spi00072  Synthesis and degradation of ketone bodies
spi00280  Valine, leucine and isoleucine degradation
spi00310  Lysine degradation
spi00362  Benzoate degradation
spi00380  Tryptophan metabolism
spi00620  Pyruvate metabolism
spi00630  Glyoxylate and dicarboxylate metabolism
spi00640  Propanoate metabolism
spi00650  Butanoate metabolism
spi00900  Terpenoid backbone biosynthesis
spi01100  Metabolic pathways
spi01110  Biosynthesis of secondary metabolites
spi01120  Microbial metabolism in diverse environments
spi01130  Biosynthesis of antibiotics
spi01200  Carbon metabolism
spi01212  Fatty acid metabolism
spi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS10750_Spy0124
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS10750_Spy0124
   00640 Propanoate metabolism
    MGAS10750_Spy0124
   00650 Butanoate metabolism
    MGAS10750_Spy0124
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MGAS10750_Spy0124
   00072 Synthesis and degradation of ketone bodies
    MGAS10750_Spy0124
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS10750_Spy0124
   00310 Lysine degradation
    MGAS10750_Spy0124
   00380 Tryptophan metabolism
    MGAS10750_Spy0124
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS10750_Spy0124
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS10750_Spy0124
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGAS10750_Spy0124
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spi04147]
    MGAS10750_Spy0124
Enzymes [BR:spi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS10750_Spy0124
Exosome [BR:spi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS10750_Spy0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ABF37074
UniProt: Q1J8T7
Position
137532..138716
Genome map
AA seq 394 aa AA seqDB search
MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLKSDAIDEVIFGNVLHA
GLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQTGNADIVLVGGTENMS
QAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAENIVQQYGLTREEQDAFA
ADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPKFGTTVDKLAKLRPAFIKD
EGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSYASAGVDPSIMGCGPIPATK
KALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKVNVNGGAIALGHPIGASGARI
LVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagtggtgatcacatctgcttatcgtaccccgataggaaattttggagga
gtctttaaatctttatcagccgtagatttgggggtgacagttgttacaaaaattttagct
gataccggtcttaaaagtgatgccattgatgaagtgatctttgggaatgtgttacatgca
ggtctgggtcaaaatgttgctcggcaagtagcgctaaatgcggggctttcttatgatacc
cctgcttttacgattgatatggtctgtggttctggcttaaaagcagttgagttaggtgct
caaaagattcaaacgggcaacgctgatattgttttagttggtggtaccgaaaacatgagt
caagcaccttacgttttacaaggccaacgttggggatctcgtatgggagatagtaaagta
gtagataccatgcttaaagatgggttgagtgatgcttttgcaggttatcacatgggtata
acagccgaaaatattgtgcaacagtatggactgaccagagaagaacaagatgcctttgca
gctgatagccaacgtaaagcccaacttgccatagaaaaaggtcgtttcaaagaagagatt
gcacctgtcactattcctcagcgtaaaggtgaacctttactcgttgatcaagatgaatac
cctaaatttggaacgacagtggataagttagcaaagttacgccctgcttttatcaaagat
gaggggacagtaactgctggtaatgcttcaggaatcaatgatggagcagcagcaatttta
ttgatgagtaaagaaaaagctgaagaattagggctccctattttagctaaaatcactagt
tatgcaagtgcaggtgtagacccaagtattatgggctgcggaccaatacctgctacgaaa
aaggctcttgcaaaggctcagctgacaattgatgacattgatttgattgaagcaaacgaa
gcttttgctgctcaggctttagcggtttcacgagaccttggttttgacaatgaaaaagtt
aatgtcaatggaggagctattgctttgggtcacccgattggagcatcaggtgctcgtatt
ttagtcaccttattagcagaaatggctaagcgtgatgtgagacatggcttagcaacgctt
tgtattggtggtggccaaggtcaaagtatcatcgtaacaagatag

DBGET integrated database retrieval system