KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0188Help
Entry
MGAS10750_Spy0188 CDS       T00356                                 

Gene name
hasC
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00040  Pentose and glucuronate interconversions
spi00052  Galactose metabolism
spi00500  Starch and sucrose metabolism
spi00520  Amino sugar and nucleotide sugar metabolism
spi01100  Metabolic pathways
spi01130  Biosynthesis of antibiotics
Module
spi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MGAS10750_Spy0188 (hasC)
   00052 Galactose metabolism
    MGAS10750_Spy0188 (hasC)
   00500 Starch and sucrose metabolism
    MGAS10750_Spy0188 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS10750_Spy0188 (hasC)
Enzymes [BR:spi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MGAS10750_Spy0188 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABF37138
UniProt: Q1J8M3
Position
complement(198101..199006)
Genome map
AA seq 301 aa AA seqDB search
MLMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTG
KSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKT
FVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAP
QAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAI
DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTK
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgtttt
ttacctgcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactatt
caatttatcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactgga
aaatccaaacgctccatagaagatcattttgattctaattttgaattagaatataattta
caggctaaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaacctt
cactttattcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagacc
tttgttggcaatgaaccttttgttgtcatgctaggtgatgatctgatggatattacaaat
ccaaatgtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgca
actattgccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcct
caagcaaaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacct
caagatgcacctagtgatttggcaattattggacgttacttgctcacaccagaaattttt
agtattttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctatt
gataccctcaataagacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgat
gttggcgataaatttgggtttatgaaaacttctttggattatgccctgaaacacccccaa
gtcaaagatgacttgaaagcctacatcatccaactgggcaaagctctagagaaaacaaaa
ccataa

DBGET integrated database retrieval system