KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0227Help
Entry
MGAS10750_Spy0227 CDS       T00356                                 

Gene name
fus
Definition
(GenBank) translation elongation factor G (EF-G)
  KO
K02355  elongation factor G
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
KEGG Orthology (KO) [BR:spi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spi03012]
    MGAS10750_Spy0227 (fus)
   03029 Mitochondrial biogenesis [BR:spi03029]
    MGAS10750_Spy0227 (fus)
Translation factors [BR:spi03012]
 Eukaryotic type
  Elongation factors
   MGAS10750_Spy0227 (fus)
 Prokaryotic type
   MGAS10750_Spy0227 (fus)
Mitochondrial biogenesis [BR:spi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MGAS10750_Spy0227 (fus)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    MGAS10750_Spy0227 (fus)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_IV EFG_II EFG_C GTP_EFTU_D2 RF3_C MMR_HSR1 AIG1
Motif
Other DBs
NCBI-ProteinID: ABF37177
UniProt: Q1J8I4
Position
238072..240150
Genome map
AA seq 692 aa AA seqDB search
MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHEGASQMDWMEQEQERG
ITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVTVLDSQSGVEPQTETVW
RQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQLPIGAEDDFRGIIDLIK
MKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETDEDLMMKYLEGEEITNDEL
IAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSPLDIPAIKGVNPDTDAEEER
PASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYVMNTSKGKRERIGRILQMHAN
SRQEIETVYAGDIAAAVGLKDTTTGDSLTDEKAKVILESIEVPEPVIQLMVEPKSKADQD
KMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLDVLVDRMKREFKVEANVGAPQVS
YRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEEGKGFEFENAIVGGVVPREFIPAV
EKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSSETAFKIAASLALKEAAKSAQPAIL
EPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSA
TQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgaattttcacttgcaaaaactcgtaatatcggtatcatggctcacgtcgat
gctggtaaaacaactacaacagagcgtatcctttactacactggtaaaattcataaaatc
ggtgaaacacacgaaggcgcatcacaaatggactggatggagcaagagcaagaacgtggt
atcactattacttctgccgctacaacagctcaatgggatggtcaccgcgttaacatcatc
gacacaccaggacacgtggacttcaccatcgaagtacaacgttctctccgtgttcttgat
ggtgctgtaaccgttcttgactcacaatcaggtgttgagcctcaaactgaaacagtttgg
cgtcaagcaactgaatacggtgttccacgtatcgttttcgccaacaaaatggataaaatc
ggtgctgacttcctttactcagtacaaacccttcatgaccgtcttcaagcaaatgcacac
ccaatccaattgccaatcggtgcagaagatgatttccgtggtatcattgacttgatcaag
atgaaagcagaaatctataccaacgaccttggtacagatattcttgaagaagatattcca
gaagaatacttagaacaagctcaagaataccgtgaaaaattaatcgaagcagttgctgaa
actgatgaagacttgatgatgaaataccttgaaggtgaagaaatcactaacgacgaattg
attgctggtatccgtaaagcaacaatcaacgttgaattcttcccagtactttgtggttct
gccttcaaaaacaaaggtgttcaattgatgcttgatgcggttatcgcataccttccaagc
ccacttgacatccctgcaatcaaaggtgttaacccggatacagatgctgaagaagaacgt
ccagcatctgatgaagagccatttgcagctcttgccttcaagatcatgactgacccattc
gtaggtcgtttgacattcttccgtgtttactcaggtgttcttaatagcggttcttacgtt
atgaacacatcaaaaggtaaacgtgagcgtatcggacgtatccttcaaatgcacgcaaac
agccgtcaagaaattgaaacagtttacgctggtgacatcgctgccgctgttggtttgaaa
gacacaacaactggtgactcattgactgatgaaaaagcaaaagttattcttgagtcaatc
gaagttccagaaccagttatccagttgatggttgagccaaaatctaaagcagaccaagac
aagatgggtgttgcccttcaaaaacttgctgaagaagatccaacattccgcgttgaaaca
aacgttgaaactggtgaaacagttatcgctggtatgggtgaacttcaccttgatgtcctt
gttgaccgtatgaaacgtgagttcaaagttgaagctaacgttggtgctcctcaagtatct
taccgtgaaacattccgtgcttctacacaagctcgtggattcttcaaacgccaatctggt
ggtaaaggtcaattcggtgatgtttggattgaatttacaccaaatgaagaaggtaaaggt
ttcgaattcgaaaatgctatcgttggtggtgtggttcctcgtgaatttatcccagctgtt
gaaaaagggttgatcgaatctatggcaaacggtgttcttgcaggttacccaatggttgat
gttaaagctaagctttacgatggttcataccacgatgtcgactcatctgaaactgccttc
aagatagctgcatcacttgcacttaaagaagcagctaaatctgcacaaccagctatcctt
gagccgatgatgcttgtaacgattacagctccagaagataatcttggagacgttatggga
cacgtgacagctcgtcgtggacgcgttgatggtatggaagcacatggtaacagccaaatc
gttcgtgcttatgtaccacttgctgaaatgttcggttatgcaacagttcttcgttctgca
actcaaggacgtggtacgttcatgatggtatttgaccactatgaagatgttcctaagtca
gttcaagaagaaatcattaagaaaaacaaaggtgaataa

DBGET integrated database retrieval system