KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0559
Entry
MGAS10750_Spy0559 CDS       T00356                                 

Definition
(GenBank) hypothetical cytosolic protein
  KO
K09762  uncharacterized protein
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
KEGG Orthology (KO) [BR:spi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MGAS10750_Spy0559
SSDB
Motif
Pfam: LAGLIDADG_WhiA HTH_WhiA WhiA_N Phage_int_SAM_2 LAGLIDADG_3
Other DBs
NCBI-ProteinID: ABF37509
UniProt: Q1J7K2
Position
544923..545834
AA seq 303 aa
MSFTTKVKEELIHLSTGDNNELAAIIKLSGSLGLAHQSLHLSITTENAKIARYIYSLIED
AYVIVPEIRYHQKTNLRKNRVYTVYVEQGVETILADLKLADSFFGLETGIEPQVLSDDNA
GRSYLKGAFLAAGSIRDPESGKYQLEIYSVYLDHAQDLAQLMQKFMLDAKTIEHKSGAVT
YVQKAEDIMDFLIIIGAMSCKEDFEAIKLLREARNDINRANNAETANIAKTISASMKTIN
NIIKIMDTIGLESLPIELQQVAQLRVKHPDYSIQQVADALEFPITKSGVNHRLRKINKIA
DDL
NT seq 912 nt   +upstreamnt  +downstreamnt
atgagttttacaaccaaggtcaaagaggaattaattcacttgtccacaggtgacaacaat
gaattggccgccattatcaaattatcaggcagcttgggcttagctcaccaaagccttcat
ttatccattaccactgaaaatgctaaaattgcccgctacatttattctcttattgaagac
gcctatgttatcgtgccagaaatcaggtatcatcaaaagacgaacctgcgcaaaaaccgt
gtttacaccgtctatgttgagcaaggtgtggaaaccattttagccgatttgaaattagcg
gactccttttttggtctggaaacaggcatcgaacctcaggttttatcagacgataatgct
ggccgttcttatcttaaaggggcttttctagcggcaggtagcatcagagatcctgagtca
ggcaagtatcagttagaaatctattcagtttatcttgatcatgctcaagatttagctcaa
ctcatgcaaaaatttatgctagatgccaaaaccatcgagcataaaagcggtgcagttact
tatgtgcaaaaggcagaagatatcatggactttttaattataattggtgccatgtcctgc
aaagaagactttgaagccatcaaattacttcgagaagctcgaaatgatattaaccgtgcc
aataatgcagaaacagctaatattgccaaaactatcagtgctagcatgaaaactattaat
aatattattaaaatcatggacacaattggtttagaaagtttaccgattgaattgcaacag
gtagcccagcttcgggttaagcatccagactattccattcaacaagttgctgatgccctt
gagttcccaatcaccaagagcggggtcaaccatcgcttgcgtaaaatcaataaaattgca
gatgacttatag

DBGET integrated database retrieval system