KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0747
Entry
MGAS10750_Spy0747 CDS       T00356                                 

Gene name
trmD
Definition
(GenBank) tRNA (Guanine-N(1)-)-methyltransferase
  KO
K00554  tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
KEGG Orthology (KO) [BR:spi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spi03016]
    MGAS10750_Spy0747 (trmD)
Enzymes [BR:spi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.228  tRNA (guanine37-N1)-methyltransferase
     MGAS10750_Spy0747 (trmD)
Transfer RNA biogenesis [BR:spi03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    MGAS10750_Spy0747 (trmD)
SSDB
Motif
Pfam: tRNA_m1G_MT SPOUT_MTase TetR_C_27
Other DBs
NCBI-ProteinID: ABF37697
UniProt: Q1J777
Position
724493..725212
AA seq 239 aa
MKIDILTLFPEMFAPLEHSIVGKAKEKGLLDIHYHNFRDYAEKARHVDDEPYGGGQGMLL
RAQPIFDTIEQIEAKKPRIILLDPAGKPFTQAYAEELALEEELIFICGHYEGYDERIKTL
VTDEISLGDFVLTGGELAAMTIVDATVRLIPQVLGKESSHQDDSFSSGLLEYPQYTRPYD
YRGMTVPDVLMSGHHERIRLWRLEESLRKTYLRRPDLLERYDFSEEERKLLDKIKEALG
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaagattgatattttaaccctttttcctgaaatgtttgctcccctagaacattccatt
gtaggcaaggcaaaagaaaaaggtctgttagacattcactaccataactttcgagattat
gctgaaaaagctcgtcatgtggatgacgaaccctatggtgggggccaaggcatgttattg
agagcgcagcccatttttgacaccattgaacagattgaagccaaaaaaccaaggattatt
cttttagatccagcaggtaaaccctttactcaggcttatgctgaagaattagctcttgag
gaagagttaatttttatttgtggtcattatgaaggttatgatgagcggattaagaccttg
gtgacggatgaaatttcattaggtgactttgtattaacaggaggtgagttggcggccatg
actatagtggatgcgaccgtcaggttaattccacaggtacttgggaaagaaagtagccat
caggacgattctttttcatcaggacttttagaataccctcaatacacaagaccttatgat
tatcgtggtatgacagttccagatgttctaatgagtggtcatcacgaacgtattcgcttg
tggcgtctagaagaaagtctcagaaaaacctatttgagaaggccagatttgttagagcgg
tacgatttttccgaggaagagcgcaagctattggataagattaaagaagcattgggttaa

DBGET integrated database retrieval system