KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0925Help
Entry
MGAS10750_Spy0925 CDS       T00356                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00230  Purine metabolism
spi00240  Pyrimidine metabolism
spi01100  Metabolic pathways
spi01110  Biosynthesis of secondary metabolites
spi01130  Biosynthesis of antibiotics
Module
spi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
spi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
spi_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:spi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MGAS10750_Spy0925
   00240 Pyrimidine metabolism
    MGAS10750_Spy0925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spi04131]
    MGAS10750_Spy0925
Enzymes [BR:spi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     MGAS10750_Spy0925
Membrane trafficking [BR:spi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    MGAS10750_Spy0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF37875
UniProt: Q1J6V8
Position
882010..882141
Genome map
AA seq 43 aa AA seqDB search
MRWIERLRFTFERFELRQASSKYLAKHDETLVINLLILNLKLT
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
ttgcggtggattgaacgcctaagatttacgtttgagcgattcgagctaagacaagctagt
tcgaaatacttggctaagcacgacgagaccttggtgataaaccttttgatcctaaactta
aagcttacatga

DBGET integrated database retrieval system