KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0926Help
Entry
MGAS10750_Spy0926 CDS       T00356                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00230  Purine metabolism
spi00240  Pyrimidine metabolism
spi01100  Metabolic pathways
spi01110  Biosynthesis of secondary metabolites
spi01130  Biosynthesis of antibiotics
Module
spi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
spi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
spi_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:spi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MGAS10750_Spy0926
   00240 Pyrimidine metabolism
    MGAS10750_Spy0926
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spi04131]
    MGAS10750_Spy0926
Enzymes [BR:spi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     MGAS10750_Spy0926
Membrane trafficking [BR:spi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    MGAS10750_Spy0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ABF37876
UniProt: Q1J6V7
Position
882209..882409
Genome map
AA seq 66 aa AA seqDB search
MMRVTNPTDALCGTIRGNFAQALGDDGGIFNMAYGSHSRDSARREIVLWAHQSNLGSSAI
LLQDNP
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgatgagagtaaccaatcctacggatgctctttgcggaaccattcgtgggaattttgct
caggctcttggtgatgatggaggtatttttaacatggcgtatgggtctcattcaagagac
tctgctaggcgtgagattgtcctttgggctcatcaaagtaatctcggtagctccgctatt
ctcttgcaagataatccgtaa

DBGET integrated database retrieval system