KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1043Help
Entry
MGAS10750_Spy1043 CDS       T00356                                 

Gene name
oadA2
Definition
(GenBank) Na+ transporting oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00620  Pyruvate metabolism
spi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS10750_Spy1043 (oadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spi02000]
    MGAS10750_Spy1043 (oadA2)
Enzymes [BR:spi01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     MGAS10750_Spy1043 (oadA2)
Transporters [BR:spi02000]
 Other transporters
  Primary active transporters [TC:3]
   MGAS10750_Spy1043 (oadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ABF37993
UniProt: Q1J6J0
Position
988894..990300
Genome map
AA seq 468 aa AA seqDB search
MIQFGGFSMQQQVAITETVLRDGHQSLMATRLSIEDMLPVLTILDKIGYYSLECWGGATF
DACIRFLNEDPWERLRTLKKGLPNTRLQMLLRGQNLLGYRHYADDIVDKFISLSAQNGID
VFRIFDALNDPRNIQQALRAVKKTGKEAQLCIAYTTSPVHTLNYYLSLVKELVEMGADSI
CIKDMAGILTPKAAKELVSGIKAMTNLPLIVHTHATSGISQMTYLAAVEAGADRIDTALS
PFSEGTSQPATESMYLALKEAGYDITLDETLLEQAANHLRQARQKYLADGTLDPSLLFPD
PRTLQYQVPGGMLSNMLSQLKQANAESKLEDVLAEVPRVRKDLGYPPLVTPLSQMVGTQA
AMNVILGKPYQMVSKEIKQYLAGEYGKTPAPVNEDLQKSQIGSTTLTTNRPADQLNPEFE
VLKAEIADLAQTDEDVLTYALFPSVAKTFLTTKYQTDDVIKVTAFIKA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgattcagtttggaggttttagcatgcagcagcaagtcgcaataacagaaacagtttta
cgggacggtcatcaaagtttgatggcaacgcgtttatctattgaggatatgcttcctgtc
cttaccatcttagacaagattggttactattccctagagtgttggggaggagcaaccttt
gatgcctgtattcgttttttgaacgaagacccttgggaaaggctgcgcacgttaaaaaaa
ggcttacctaatacccgtttacaaatgttattaagaggccaaaaccttttaggctaccgt
cattatgcagatgacatcgttgataaattcattagtttatcagctcaaaatgggattgat
gttttccgcatttttgatgccctaaatgacccacgaaatatccagcaagccttaagagct
gtgaaaaagacggggaaagaggctcaactgtgtattgcctatacaactagcccagtgcac
acgcttaactattacctttctttagtgaaagaattggttgagatgggagctgattctatc
tgcatcaaagatatggctggtattctaactcccaaagcggctaaagagttggtatctggt
atcaaagccatgactaacttacctcttattgtgcatacccatgcaactagtggcatttct
cagatgacctatctagcagcagtagaagctggggctgatagaattgataccgctttgtca
ccttttagcgaaggcacttcacaacctgctacagaatctatgtatttagccttaaaagaa
gcaggttatgatatcacattagatgaaacgctactggaacaagctgctaatcaccttcgt
caagcccgccaaaagtatttagctgatggaactctggacccaagtcttctctttccagac
ccaagaacgctacaatatcaagttcctggaggcatgttatctaatatgctatctcaactg
aaacaagctaatgccgaatcaaaattagaagatgttttagcggaagttcctcgggtaaga
aaagacttaggttacccaccgttagtaacgccacttagtcaaatggtcgggactcaagct
gctatgaatgtgattttagggaaaccttatcaaatggtgtccaaagaaatcaaacaatat
ttagcaggagaatatgggaagacacctgcacctgtcaatgaagacctgcaaaagagtcaa
attggatcaacaacactaaccactaatcgtcctgcagaccagttgaatcctgaatttgaa
gtattgaaggcagaaatagcagatttagcccaaacggacgaagatgtgctgacctatgct
ctcttcccaagcgtagcaaaaacatttttaacaaccaaataccaaactgatgacgtcatt
aaagtgactgcctttatcaaagcatag

DBGET integrated database retrieval system