KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1166Help
Entry
MGAS10750_Spy1166 CDS       T00356                                 

Gene name
dltA
Definition
(GenBank) D-alanine-activating enzyme
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00473  D-Alanine metabolism
spi01503  Cationic antimicrobial peptide (CAMP) resistance
spi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGAS10750_Spy1166 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGAS10750_Spy1166 (dltA)
 09160 Human Diseases
  09168 Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    MGAS10750_Spy1166 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:spi01504]
    MGAS10750_Spy1166 (dltA)
Enzymes [BR:spi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     MGAS10750_Spy1166 (dltA)
Antimicrobial resistance genes [BR:spi01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    MGAS10750_Spy1166 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABF38116
UniProt: Q1J667
Structure
PDB: 

Position
complement(1113739..1115277)
Genome map
AA seq 512 aa AA seqDB search
MIKDMIDSIEQFAQTQADFPVYDCLGERRTYGQLKRDSDSIAAFIDSLALLAKSPVLVFG
AQTYDMLATFVALTKSGHAYIPVDVHSAPERILAIIEIAKPSLIIAIEEFPLTIEGISLV
SLSEIESAKLAEMPYERTHSVKGDDNYYIIFTSGTTGQPKGVQISHDNLLSFTNWMIEDA
AFDVPKQPQMLAQPPYSFDLSVMYWAPTLALGGTLFALPKELVADFKQLFTTIAQLPVGI
WTSTPSFADMAMLSDDFCQARMPALTHFYFDGEELTVSTARKLFERFPSAKIINAYGPTE
ATVALSAIEITREMVDNYTRLPIGYPKPDSPTYIIDEDGKELASGEQGEIIVTGPAVSKG
YLNNPEKTAEAFFTFKGQPAYHTGDIGSLTEDNILLYGGRLDFQIKYAGYRIELEDVSQQ
LNQSPMVASAVAVPRYNKEHKVQNLLAYIVVKDGVKERFDRELELTKAIKASVKDHMMSY
MMPSKFLYRDSLPLTPNGKIDIKTLINEVNNR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggatatgattgacagtattgagcagtttgctcagacacaggctgatttccca
gtttatgattgtttaggggaacgccgaacttacggacaactcaaaagagattctgatagc
attgctgcatttatagatagcttagctttactggcaaaatctccagttttggtttttggg
gcgcaaacttatgatatgttagctacttttgtagctttaaccaaatctggtcatgcctat
atcccagtagatgtgcattcagcaccagaacgtattttagcgattattgagattgcaaag
cccagtttaatcattgctattgaggaattccctcttactattgaagggatttcccttgtc
tcactatcagagattgagtcagcaaaattagcagaaatgccctatgagcgaacacattct
gttaaaggagatgataattattacattattttcacctctggaacaacgggccaaccaaaa
ggggtgcaaatttcacatgacaatcttttgagctttaccaactggatgatcgaagatgca
gcatttgatgtacctaaacagccacaaatgctggcgcagccaccctattcctttgacctt
tctgtcatgtactgggcacctaccttggctttaggtggaaccttatttgcacttccaaaa
gaattggtggcagactttaaacagttatttacaacgattgcgcaacttccagttggcatt
tggacatcgactccttcatttgctgatatggccatgcttagcgatgatttttgccaggct
aggatgccagctttaacgcatttttattttgatggcgaagaattaaccgtttctacggct
cgaaaactctttgaacgtttcccgagtgccaagattatcaatgcctatggaccaacagaa
gcgactgtagccttatccgctattgaaattaccagagaaatggtggataattatacccgc
ttgccgattggctaccccaaaccagattctccgacctatattattgatgaagatggtaag
gagttagcttcaggggagcagggtgaaattattgttacagggcctgctgtgtcaaaaggt
tacctcaacaatcctgagaaaaccgcagaagctttctttacttttaaaggacagcctgct
tatcatacaggggacattggctcactgacagaagataatattttgctgtatggtgggcgt
ttggattttcagattaaatatgctggttatcgtattgaactagaagatgtttcccaacag
ttgaatcaatcaccaatggtagcatcggctgtggctgttccaaggtacaataaagaacat
aaggttcaaaatctcttggcctatatcgttgtcaaagatggggttaaagagcgttttgat
agggaattggagttaaccaaagctatcaaagcctctgttaaggatcatatgatgagttat
atgatgccttctaagtttctttatcgagacagtctaccattgactccaaatggtaagata
gatattaaaactttgattaatgaggtcaataaccgatga

DBGET integrated database retrieval system