KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1181Help
Entry
MGAS10750_Spy1181 CDS       T00356                                 

Gene name
obg
Definition
(GenBank) GTP-binding protein CgtA
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
KEGG Orthology (KO) [BR:spi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spi03009]
    MGAS10750_Spy1181 (obg)
Enzymes [BR:spi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     MGAS10750_Spy1181 (obg)
Ribosome biogenesis [BR:spi03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   MGAS10750_Spy1181 (obg)
 Prokaryotic type
  GTPases
   MGAS10750_Spy1181 (obg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG DUF1967 MMR_HSR1 FeoB_N MeaB ATP_bind_1 GTP_EFTU Gtr1_RagA Arf MMR_HSR1_C PduV-EutP NOG1
Motif
Other DBs
NCBI-ProteinID: ABF38131
UniProt: Q1J652
Position
complement(1129521..1130834)
Genome map
AA seq 437 aa AA seqDB search
MSMFLDTAKISVQAGRGGDGMVAFRREKYVPNGGPWGGDGGKGGSVIFRVDEGLRTLMDF
RYNRKFKAKSGEKGMTKGMHGRGAEDLIVFVPQGTTVRDAETGKVITDLVEHGQEVVIAK
GGRGGRGNIRFATPRNPAPEIAENGEPGEERQLELELKILADVGLVGFPSVGKSTLLSVV
SSAKPKIGAYHFTTIVPNLGMVRTKSGDSFAMADLPGLIEGASQGIGLGTQFLRHIERTR
VILHVIDMSASEGRDPYEDYVSINNELETYNLRLMERPQIIVANKMDMPEAQENLKAFKK
KLAAQYDEFDDLPMIFPISSLAHQGLENLLEATAELLAKTDEFLLYDEADLVDEEAYYGF
AETEKDFEITRDDDATWVLSGEKLERLFVMTNMERDESIMKFARQLRGMGVDEALRERGA
KDGDLVRIGKFEFEFVD
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgtttttagatacggcaaaaatcagtgtccaagcaggccgtggtggcgatggt
atggtagcttttcgtcgtgaaaagtacgtcccaaatggcggtccttggggaggagacggc
ggtaaaggtggctcagttatcttccgagtggacgaaggtttgcgtaccttgatggatttc
cggtataatcgtaaattcaaggcgaaatctggtgaaaaaggtatgaccaaaggcatgcac
ggccgtggtgcagaagatttgattgtctttgttcctcaagggacaacggttcgtgatgct
gaaactggaaaagtaattacagacttagtagaacatggtcaagaagtggtcattgctaag
ggtggtcgtggtggccgtgggaatattcgttttgcaactcctcgtaatcctgcgccagag
attgctgaaaatggtgagccaggtgaggaacgtcagttagagttagaactcaaaatctta
gctgacgttggcttggtcggattcccatctgttgggaaatcaactttgttaagtgttgtg
tcatcagctaaaccgaaaattggtgcctatcattttaccactattgttcctaatcttgga
atggttcgtacaaagtcaggtgatagctttgctatggcagatctgccaggtttgattgaa
ggtgctagccaagggattggtttgggaactcaattcctccgtcatatcgagcggacacgg
gttattcttcatgtgattgacatgtctgctagtgagggtcgtgatccttacgaagattat
gtttccattaataacgagctggaaacctataatttgcgattgatggagcgcccacagatt
attgtggctaataaaatggacatgccagaggctcaagaaaacttgaaagccttcaagaaa
aaattggctgcccaatatgacgagtttgatgatttgccaatgattttccctatttcaagc
ctagcacatcaaggcttagagaacttgttagaagcaacggcagaattacttgctaaaaca
gacgaattcttattatatgatgaagctgatctggtggatgaagaagcttactatggcttt
gcagaaactgaaaaagactttgagattacccgagatgatgatgctacttgggtcttgtct
ggtgagaaattggaacgtctctttgtcatgaccaatatggaacgtgacgaatccatcatg
aaatttgcccgtcaattgcgcggtatgggggttgacgaagcccttcgtgaacgtggagca
aaagacggggatcttgttcgtattggcaaatttgaatttgaatttgtggattaa

DBGET integrated database retrieval system