KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1267Help
Entry
MGAS10750_Spy1267 CDS       T00356                                 

Gene name
recR
Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MGAS10750_Spy1267 (recR)
DNA repair and recombination proteins [BR:spi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     MGAS10750_Spy1267 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MGAS10750_Spy1267 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: ABF38217
UniProt: Q1J5W6
Position
complement(1212657..1213352)
Genome map
AA seq 231 aa AA seqDB search
MRLLLCIHILRIYRQRCEGALCGDIWKTIKENLVLYPTPIAKLIDSYSKLPGIGIKTATR
LAFYTIGMSNEDVNDFAKNLLAAKRELTYCSICGNLTDDDPCHICTDTSRDQTTILVVED
AKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPDDINLKSLITRLMDGKVSEVIVATNATA
DGEATSMYISRVLKPAGIKVTRLARGLAVGSDIEYADEVTLLRAIENRTEL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
ttgcggttgctgttatgtatccacatattacgaatatatcggcaaagatgtgagggcgct
ttatgtggcgatatatggaaaacaataaaggagaacttagtgctttatccaacacccatt
gcaaagttaattgacagttactctaaacttccaggaattggtatcaagacggcgacgaga
ttagccttttatactattggaatgtcaaatgaagatgtcaatgattttgctaaaaactta
ttagcagctaaaagagaactgacctattgttcgatttgtggaaaccttaccgatgacgat
ccttgtcacatttgcacagacacgagtcgtgatcagacgaccattctggtagtagaagat
gctaaagatgtttctgccatggaaaaaatccaagagtatcatggctattatcatgtgctt
cacggcttgatttcgcctatgaatggtgtggggccagatgacatcaaccttaaaagttta
attacccgtctaatggatggtaaggtgagcgaagttatcgtagctaccaatgccacagca
gatggggaagcaacgtccatgtatatttcacgtgtcttgaaaccagccgggattaaggta
actcgtttggcaagaggtctcgcagtaggttcagatattgagtatgctgatgaagtaaca
ttattgagagctattgagaatcgtactgaactttaa

DBGET integrated database retrieval system