KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1451Help
Entry
MGAS10750_Spy1451 CDS       T00356                                 

Definition
(GenBank) Hydrolase
  KO
K18682  ribonucrease Y [EC:3.1.-.-]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:spi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MGAS10750_Spy1451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spi03019]
    MGAS10750_Spy1451
Enzymes [BR:spi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     MGAS10750_Spy1451
Messenger RNA biogenesis [BR:spi03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     MGAS10750_Spy1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3552 HD KH_1 HDOD KH_2 KH_4 dUTPase
Motif
Other DBs
NCBI-ProteinID: ABF38401
UniProt: Q1J5I5
Position
complement(1386269..1387876)
Genome map
AA seq 535 aa AA seqDB search
MVNIILLIVSALIGLILGYALISIRLKSAKEAAELTLLNAEQEAVDIRGKAEVDAEHIKK
TAKRESKANRKELLLEAKEEARKYREEIEQEFKSERQELKQLETRLAERSLTLDRKDENL
SSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKKAELEKVAAMTIAEAREVILMETEN
KLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVTEQTITSVHLPDDNMKGRI
IGREGRNIRTLESLTGIDVIIDDTPEVVILSGFDPIRREIARMTLESLIADGRIHPARIE
ELVEKNRLEMDNRIREYGEAAAYEIGAPNLHPDLIKIMGRLQFRTSFGQNVLRHSVEVGK
LAGILAGELGENVALARRAGFLHDMGKAIDREVEGSHVEIGMEFARKYKEHPVVVNTIAS
HHGDVEPDSVIAVLVAAADALSSARPGARNESMENYIKRLRDLEEIATSFDGVQNSFALQ
AGREIRIMVQPEKISDDQVVILSHKVREKIENNLDYPGNIKVTVIREMRAVDYAK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggttaatattattttattaattgtttctgccctcattggtttaatattaggttatgca
cttatttcgattagactcaagtctgcgaaggaagctgcagagttgactcttttaaacgct
gaacaagaagctgttgatattcgtggcaaagcagaagtagatgctgaacacatcaaaaaa
acagctaaacgtgaaagtaaagcaaatcgtaaagaattacttttagaagcaaaagaagag
gcaagaaaatatcgtgaagagattgaacaagaatttaagtctgaaagacaagagcttaaa
caactcgagacacgcttagcggagcgctccttaactcttgaccgtaaagatgaaaaccta
tcaagtaaagaaaaggtactagatagtaaagaacaaagtctgaccgataaatctaaacac
attgatgagcggcaacttcaagtagaaaaacttgaagaggagaaaaaagcagaactggaa
aaagttgctgcgatgacgattgcagaagcgcgtgaagtgattttaatggagacggaaaac
aaactgacccatgaaattgcgacgcgcattcgagatgccgaacgtgacatcaaggaccga
acagttaaaacagccaaggacttgttagcgcaagccatgcaacgccttgctggtgagtat
gtgactgaacaaactattaccagtgtccatctcccagacgacaacatgaagggccgaatt
attggacgtgaaggccgtaatattcgtactttagagagcttgactggcattgacgttatt
attgacgatactcctgaagttgttatcttatcaggatttgatcctattcgacgtgaaatt
gctcgtatgaccttggaatctctgattgctgatggtcgcatccatccagctcgtatcgag
gaattggttgagaaaaatcgtcttgaaatggataatcgtattcgtgagtacggtgaagct
gcagcctatgagattggtgcaccaaaccttcatcctgatttgattaaaatcatgggacgc
ctgcaattccgtacctcgtttggtcaaaatgtcctacgtcactctgttgaggttggtaag
ttagctggtattttagctggtgagttaggtgaaaatgttgctcttgcccgccgtgctggt
ttcttgcatgatatgggtaaagctattgaccgtgaggttgaaggtagtcacgttgagatt
ggaatggaatttgcacgtaaatacaaagaacatccagttgttgtcaacactattgctagc
caccacggagatgtggagccagattctgtgattgctgtgctagtagctgcagcagacgct
ctcagttcggctcgtccaggcgctcgtaatgagtcaatggagaattacatcaagcgtctt
cgtgatttagaagaaatcgcgacaagttttgatggggtacaaaatagttttgctctacaa
gctggacgtgagattcgtattatggttcaacctgaaaaaatttcagatgatcaggttgtc
attttgtcgcataaggtaagagaaaaaattgaaaacaatctagattacccaggaaatatt
aaagtaactgttattcgtgagatgagagcggttgattatgccaagtag

DBGET integrated database retrieval system