KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1542Help
Entry
MGAS10750_Spy1542 CDS       T00356                                 

Gene name
serS
Definition
(GenBank) Seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MGAS10750_Spy1542 (serS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spi01007]
    MGAS10750_Spy1542 (serS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spi03016]
    MGAS10750_Spy1542 (serS)
Enzymes [BR:spi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     MGAS10750_Spy1542 (serS)
Amino acid related enzymes [BR:spi01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   MGAS10750_Spy1542 (serS)
Transfer RNA biogenesis [BR:spi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MGAS10750_Spy1542 (serS)
 Prokaryotic type
    MGAS10750_Spy1542 (serS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N DUF3450 Baculo_PEP_C TMPIT NPV_P10
Motif
Other DBs
NCBI-ProteinID: ABF38492
UniProt: Q1J594
Position
1475593..1476870
Genome map
AA seq 425 aa AA seqDB search
MLDLKRIRTDFDTVAAKLKNRGVSEDTLTHLKELDEKRRTLLVQSEELKAERNIASAAIA
QAKRQKEDATQQIADMQKVSADIKTIDNQLVAIDQQVTDIITVLPNTPHDSVPVGADEED
NVEIRRWGTPRDFDFEVKAHWDLGEDLDILDWERGAKVTGARFLFYKNLGARLERALYNF
MLDEHIKEGYQEIITPYMVNHDSMFGTGQYPKFKEDTFELADTNFVLIPTAEVPLTNYYR
GEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYQELEK
MTANAENILQKLGLPYRVISLCTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTEDFQA
RRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMGGET
VISPK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctagatcttaaacgtatccgtaccgattttgacactgtcgctgccaaattaaaaaac
cgtggtgtttctgaagacaccctgacccatcttaaagaacttgatgaaaaacgtcgtact
ctattagtgcaatcagaagaattaaaagcagagcgtaatattgcttctgctgccatcgct
caagccaaacgtcaaaaagaagatgccactcaacaaattgctgatatgcaaaaagtctct
gcagatatcaaaactattgacaatcaactagtagctatcgaccagcaagttactgacatc
atcactgttttacctaatactcctcacgattctgtccctgttggagctgacgaagaagac
aatgtcgaaattcgccgttggggaacgcctcgtgactttgacttcgaagttaaggctcat
tgggatctaggcgaagatcttgatattttagactgggaacgtggggcaaaggtaactggt
gctcgtttcttattctataaaaatcttggtgctcgtttggagcgtgctctttataacttc
atgctggatgaacatatcaaagaaggttatcaagaaatcatcacaccttacatggttaac
cacgattccatgtttggtacaggacaatatccaaaattcaaagaggacacctttgaatta
gcagataccaactttgtcctgattccaactgctgaagtgcctttgaccaattattaccgt
ggggaaatcctagacggcaaagaattgccaatttactttactgcaatgagtccatctttt
cgttctgaagcgggttctgcgggtcgtgacacacgtggccttatccgcctacaccaattc
cacaaagttgaaatggttaaatttgctaaaccagaagaatcttaccaagaactagaaaaa
atgactgctaatgctgaaaatattcttcaaaaacttggtttgccatatcgcgtcatttcc
ctttgtactggagacatgggcttctcagctgctaaaacctatgaccttgaagtctggatt
cctgcacaaaatacctatcgtgaaatttcatcatgttcaaatacagaagatttccaagca
cgacgtgctcaaatccgttaccgtgatgaagctgacggcaaggtcaaacttcttcacacc
cttaatgggtcaggacttgctgtcggtcgtaccgtagcagccattttagaaaactaccaa
aatgaagatggttctgttaccatccctgaagtactccgcccttacatgggtggcgaaacc
gtcatttcacctaaataa

DBGET integrated database retrieval system