KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1558Help
Entry
MGAS10750_Spy1558 CDS       T00356                                 

Gene name
dnaK
Definition
(GenBank) Chaperone protein dnaK
  KO
K04043  molecular chaperone DnaK
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:spi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MGAS10750_Spy1558 (dnaK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spi03019]
    MGAS10750_Spy1558 (dnaK)
   03110 Chaperones and folding catalysts [BR:spi03110]
    MGAS10750_Spy1558 (dnaK)
   03029 Mitochondrial biogenesis [BR:spi03029]
    MGAS10750_Spy1558 (dnaK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spi04147]
    MGAS10750_Spy1558 (dnaK)
Messenger RNA biogenesis [BR:spi03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     MGAS10750_Spy1558 (dnaK)
Chaperones and folding catalysts [BR:spi03110]
 Heat shock proteins
  HSP70 / DNAK
   MGAS10750_Spy1558 (dnaK)
Mitochondrial biogenesis [BR:spi03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    MGAS10750_Spy1558 (dnaK)
  Matrix
   MMC/PAM proteins
    MGAS10750_Spy1558 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    MGAS10750_Spy1558 (dnaK)
Exosome [BR:spi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGAS10750_Spy1558 (dnaK)
  Exosomal proteins of breast cancer cells
   MGAS10750_Spy1558 (dnaK)
  Exosomal proteins of colorectal cancer cells
   MGAS10750_Spy1558 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA Hydantoinase_A
Motif
Other DBs
NCBI-ProteinID: ABF38508
UniProt: Q1J578
Position
complement(1489380..1491206)
Genome map
AA seq 608 aa AA seqDB search
MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNGEIIVGDAAKRQAVTN
PETVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDYLGEKVEKAVITVPAYF
NDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKTDKDEKILVFDLGGGTFDVSILE
LGDGVFDVLATAGDNKLGGDDFDQKIIDFLVAEFKKENGIDLSQDKMALQRLKDAAEKAK
KDLSGVTQTQISLPFITAGSAGPLHLEMSLSRAKFDDLTRDLVERTKTPVRQALSDAGLS
LSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEVVAMGAAIQGGVITGDVKDVV
LLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMAAD
NKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKAKDLGTQKEQHIVIKSNDGLSEE
EIDRMMKDAEANAEADAKRKEEVDLKNEVDQAIFATEKTIKETEGKGFDTERDAAQSALD
ELKAAQESGNLDDMKAKLEALNEKAQALAVKMYEQAAAAQQAAQGAEGAQANDSANNDDV
VDGEFTEK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattattggtattgacttaggtacaacaaactcagcagtagcagttcttgaa
gggactgaatcaaaaatcattgctaacccagaaggcaatcgtacaactccttcagtagta
tcattcaaaaatggtgaaattatcgtgggtgatgctgcaaaacgtcaagcagtgacaaac
ccagaaacagtaatctctattaaatctaaaatgggaacttctgaaaaagtttctgcaaat
ggtaaagaatatactcctcaagaaatttcagcaatgattcttcaataccttaaaggttat
gctgaagactatcttggagaaaaagtagaaaaagcagttattactgttccagcttacttc
aacgatgcacaacgtcaggcaactaaagacgctggtaaaattgcaggtcttgaagtagaa
cgtatcgttaacgaaccaacagcagccgcacttgcttatggtatggacaagactgacaag
gatgaaaaaatcttagtttttgaccttggtggtggtacatttgacgtatcaatccttgaa
ttaggtgatggtgtcttcgacgttcttgcaacagcaggtgataacaaacttggtggtgac
gactttgaccagaaaattattgatttcttggtggctgaatttaagaaagaaaatggtatt
gatctttctcaagacaaaatggctcttcaacgcttgaaagatgcagctgaaaaagctaaa
aaagatttgtcaggtgtaactcaaactcaaatttcattaccgttcatcactgctggttct
gctggtcctcttcacttggagatgagcttatctcgtgctaaatttgacgatctcactcgt
gaccttgttgaacgtacgaaaactccagttcgtcaagctctttcagatgcaggattgtca
ttgtcagaaattgatgaagttatccttgttggtggatcaactcgtatcccagcagttgtc
gaagctgtaaaagctgaaactggtaaagaaccaaataaatctgtaaaccctgatgaagtg
gttgctatgggtgctgctatccaaggtggtgttatcactggggatgtgaaagacgttgtc
cttcttgacgtaacaccattgtcacttggtattgaaacaatgggtggtgtcttcactaaa
ttgatcgaccgcaatacaactatcccaacatctaaatcacaagtcttctcaacagcagca
gacaaccaaccagccgttgatatccacgttcttcaaggtgaacgcccaatggcagcagat
aacaagactcttggtcgcttccaattgactgatatcccagctgcacctcgtggaatccca
caaattgaagtaacatttgatatcgataaaaacggtattgtttctgtaaaagctaaggac
cttggtacgcaaaaggaacaacacatcgttatcaaatcaaacgacggactttctgaagaa
gaaattgatcgcatgatgaaagatgctgaagctaatgccgaagccgatgcgaaacgtaaa
gaagaagttgaccttaaaaacgaagttgaccaagctatctttgctactgaaaaaacaatc
aaagaaactgaaggtaaaggctttgatacagaacgtgatgcagcgcaatcagctcttgac
gagttaaaagctgcgcaagaatctggcaaccttgacgacatgaaagctaaacttgaagca
ttaaatgaaaaagcgcaagctttggctgttaaaatgtacgagcaagctgcagcagctcaa
caagcagcacaaggtgcagaaggtgcacaagctaatgattcagcaaataatgatgatgtt
gtagatggcgaatttacagaaaagtaa

DBGET integrated database retrieval system