KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1566Help
Entry
MGAS10750_Spy1566 CDS       T00356                                 

Gene name
gatB
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00970  Aminoacyl-tRNA biosynthesis
spi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MGAS10750_Spy1566 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spi03029]
    MGAS10750_Spy1566 (gatB)
Enzymes [BR:spi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MGAS10750_Spy1566 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MGAS10750_Spy1566 (gatB)
Mitochondrial biogenesis [BR:spi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MGAS10750_Spy1566 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Chlam_vir
Motif
Other DBs
NCBI-ProteinID: ABF38516
UniProt: Q1J570
Position
complement(1496199..1497638)
Genome map
AA seq 479 aa AA seqDB search
MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGI
QAALALNMDIHKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIDIKLEDGSTKKIRIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEIIQYTG
ISDVKMEEGSMRVDANISLRPYGQEQFGTKTELKNLNSFSNVRKGLEFEVERQAKLLRSG
GVIRQETRRYDEANKGTILMRVKEGAADYRYFPEPDLPLYEIDDAWIDEMRAQLPQFPAQ
RRAKYEEELGLSAYDASQLTATKALSDFFETAVSLGGDAKQVSNWLQGEVAQFLNAEGKT
IEEIRLTPDNLVEMIAIIADGTISSKMAKKVFVHLAKNGGSARAYVEKAGLVQISDPAVL
VPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATKGQANPQVAQQLLAQELQKLRD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaaccattattgggcttgaagtccatgtggaattaaataccaattccaaa
attttctcaccttcgtcagctcactttggtgaggacccaaatgccaacacgaatgtgatt
gattggtctttcccaggggtcttaccagtcatgaacaaaggggtgattgatgcgggcata
caagctgcgcttgccctcaatatggacatccataaagagatgcatttcgaccgcaaaaat
tatttctacccagacaatcctaaagcttaccaaatttcacagtttgatgagccgattggc
tacaacggctggattgatatcaaactagaagacggttcaaccaagaaaattcgtattgaa
cgcgcacacttggaagaagatgctggtaaaaacactcacggcacagatggttattcttat
gtggaccttaaccgccaaggagttcctttgattgagattgtgtcagaagccgacatgcgt
tctcctgaagaagcctatgcttatttgacagctctgaaagaaatcatccagtacacaggc
atttctgacgtcaagatggaagaaggctctatgcgggtggatgccaatatttcccttcgt
ccttacgggcaagaacaatttggaacaaagaccgaattgaaaaacttgaactccttctca
aatgtccgtaaagggcttgaatttgaggtggaacgtcaagccaaactcttgcgttcaggt
ggtgtgatacgccaagaaacgcgccgctatgacgaagcgaataaggggactattttgatg
cgggtcaaagaaggggcagcggactatcgttatttcccagaaccagacctgccattatat
gagattgatgatgcttggattgacgagatgcgtgctcaattacctcaattcccagctcag
cgtcgtgctaaatacgaagaggaacttggcctctcagcttatgatgctagccaactaaca
gctaccaaagccttgtcagatttctttgaaactgcagtaagtcttggtggcgatgccaag
caagtctctaactggttgcaaggggaagttgcccaattcttaaatgcagaaggcaaaacc
attgaagaaattagattgacgcctgacaacttagtggaaatgattgctattattgctgat
ggtacaatctcttctaaaatggctaagaaggtctttgtgcatttggctaaaaacggtggc
tcagctcgcgcctacgtcgaaaaggcaggacttgttcagatttctgatcccgctgttttg
gtaccaattattcaccaagtctttgctgataatgaagctgcagtggctgatttcaaatca
ggcaaacgtaatgctgataaggctttcacaggcttcttgatgaaggcaaccaaaggtcaa
gctaatccacaagtcgctcaacaattattggcacaagaattgcaaaaattgcgagattga

DBGET integrated database retrieval system